HCRTR1

설명Orexin receptor type 1

Gene and Protein Information

Gene ID3061
Uniprot Accession IDs O43613 A8K3A6 Q9HBV6 Ox-1-R
Ensembl ID ENSP00000384387
Symbol OX1R
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSVTTVLP
Show more
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp469261HCRTR1hypocretin receptor 19598VGNC:8049OMA, EggNOG
Macaque705914HCRTR1hypocretin receptor 19544Inparanoid, OMA, EggNOG
Mouse230777Hcrtr1hypocretin (orexin) receptor 110090MGI:2385650Inparanoid, OMA, EggNOG
Rat25593Hcrtr1hypocretin receptor 110116RGD:2787Inparanoid, OMA, EggNOG
Dog100855896HCRTR1hypocretin receptor 19615VGNC:41623Inparanoid, OMA, EggNOG
Horse100056164HCRTR1hypocretin receptor 19796VGNC:18714Inparanoid, OMA
Cow282248HCRTR1hypocretin receptor 19913VGNC:29781Inparanoid, OMA, EggNOG
Pig387287HCRTR1hypocretin receptor 19823OMA, EggNOG
Platypus100075542HCRTR1hypocretin receptor 19258Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Orexin receptor type 1
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Orexin receptor type 1

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.