PSMD14

설명26S proteasome non-ATPase regulatory subunit 14

Gene and Protein Information

Gene ID10213
Uniprot Accession IDs O00487 B3KNW2 O00176
Ensembl ID ENSP00000386541
Symbol POH1 PAD1 POH1 RPN11
FamilyBelongs to the peptidase M67A family. PSMD14 subfamily.
Sequence
MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK
Show more
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp459686PSMD14proteasome 26S subunit, non-ATPase 149598VGNC:2791OMA, EggNOG
Macaque701063PSMD14proteasome 26S subunit, non-ATPase 149544Inparanoid, OMA, EggNOG
Mouse59029Psmd14proteasome (prosome, macropain) 26S subunit, non-ATPase, 1410090MGI:1913284Inparanoid, OMA, EggNOG
Rat311078Psmd14proteasome 26S subunit, non-ATPase 1410116RGD:1594532Inparanoid, OMA
Dog478765PSMD14proteasome 26S subunit, non-ATPase 149615VGNC:45110Inparanoid, OMA, EggNOG
Horse100051409PSMD14proteasome 26S subunit, non-ATPase 149796VGNC:21960Inparanoid, OMA, EggNOG
Cow535683PSMD14proteasome 26S subunit, non-ATPase 149913VGNC:33465Inparanoid, OMA, EggNOG
Pig100156327PSMD14proteasome 26S subunit, non-ATPase 149823Inparanoid, OMA, EggNOG
Opossum100015662PSMD14proteasome 26S subunit, non-ATPase 1413616Inparanoid, OMA, EggNOG
Platypus100077210PSMD14proteasome 26S subunit, non-ATPase 149258Inparanoid, OMA, EggNOG
Chicken424189PSMD14proteasome 26S subunit, non-ATPase 149031CGNC:8450Inparanoid, OMA, EggNOG
Anole lizard100553139psmd14proteasome 26S subunit, non-ATPase 1428377Inparanoid, OMA, EggNOG
Xenopus595024psmd14proteasome 26S subunit, non-ATPase 148364XB-GENE-950703Inparanoid, OMA, EggNOG
Zebrafish799058psmd14proteasome 26S subunit, non-ATPase 147955ZDB-GENE-070410-56Inparanoid, OMA, EggNOG
C. elegans173744rpn-1126S proteasome non-ATPase regulatory subunit 146239Inparanoid, OMA
Fruitfly33738Rpn11Regulatory particle non-ATPase 117227FBgn0028694Inparanoid, OMA, EggNOG
S.cerevisiae850554RPN11proteasome regulatory particle lid subunit RPN114932S000001900Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.