CTRL

설명Chymotrypsin-like protease CTRL-1

Gene and Protein Information

Gene ID1506
Uniprot Accession IDs P40313
Ensembl ID ENSP00000458537
Symbol CTRL1 CTRL1
FamilyBelongs to the peptidase S1 family.
Sequence
MLLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp454179CTRLchymotrypsin like9598VGNC:9027OMA, EggNOG
Macaque701625CTRLchymotrypsin like9544Inparanoid, OMA, EggNOG
Mouse109660Ctrlchymotrypsin-like10090MGI:88558Inparanoid, OMA, EggNOG
Rat117184Ctrlchymotrypsin-like10116RGD:621501Inparanoid, OMA, EggNOG
Dog611100CTRLchymotrypsin like9615VGNC:39707Inparanoid, OMA, EggNOG
Pig100621609CTRLchymotrypsin like9823OMA, EggNOG
Opossum100021711CTRLchymotrypsin like13616Inparanoid, EggNOG
PlatypusCTRLchymotrypsin like [Source:HGNC Symbol;Acc:HGNC:2524]9258OMA, EggNOG
Anole lizard100554181ctrlchymotrypsin like28377Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.