🌎 Ship to: United States
Toggle Nav
Cart
검색
재고 상품은 당일 발송됩니다.
고급 검색
빠른 주문 SDS / CoA Structure 대량 및 사용자 정의
메뉴
계정
설정
྾
224,000+ 연구 제품 · Triple ISO certified · COA & SDS 모든 제품에 대한 사용 가능 · 주식 상품에 대한 같은 날 배송

CD79B

설명B-cell antigen receptor complex-associated protein beta chain

Gene and Protein Information

Gene ID974
Uniprot Accession IDs P40259 Q53FS2 Q9BU06
Ensembl ID ENSP00000376544
Symbol B29 IGB B29 IGB AGM6
Sequence
MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp454773CD79BCD79b molecule9598VGNC:9180OMA, EggNOG
Mouse15985Cd79bCD79B antigen10090MGI:96431Inparanoid, OMA, EggNOG
Rat171055Cd79bCD79b molecule10116RGD:620012Inparanoid, OMA, EggNOG
Dog609449CD79BCD79b molecule9615VGNC:38974Inparanoid, OMA, EggNOG
Cow509801CD79BCD79b molecule9913VGNC:27047Inparanoid, OMA, EggNOG
Pig100511898CD79BCD79b molecule9823Inparanoid, OMA, EggNOG
Opossum100026330CD79BCD79b molecule13616Inparanoid, OMA, EggNOG
Chicken419940CD79BCD79b molecule9031CGNC:147Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    immunoglobulin receptor superfamily    /    B-cell antigen receptor complex-associated protein beta chain
protein    /    receptor    /    defense/immunity protein    /    B-cell antigen receptor complex-associated protein beta chain
protein    /    receptor    /    cytokine receptor    /    B-cell antigen receptor complex-associated protein beta chain
DTO Classes
protein    /    Receptor    /    Cytokine receptor    /    Immunoglobulin receptor superfamily    /    B-cell antigen receptor complex-associated protein beta chain

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.