| 설명 | Potassium channel subfamily K member 17 |
|---|
Gene and Protein Information
| Gene ID | 89822 |
|---|---|
| Uniprot Accession IDs | Q96T54 E9PB46 Q5TCF4 Q8TAW4 Q9BXD1 Q9H592 |
| Ensembl ID | ENSP00000362328 |
| Symbol | TALK2 TASK4 TALK2 TASK4 TALK-2 TASK-4 K2p17.1 |
| Family | Belongs to the two pore domain potassium channel (TC 1.A.1.8) family. |
| Sequence | MYRPRARAAPEGRVRGCAVPSTVLLLLAYLAYLALGTGVFWTLEGRAAQDSSRSFQRDKWELLQNFTCLDRPALDSLIRDVVQAYKNGASLLSNTTSMGRWELVGSFFFSVSTITTIGYGNLSPNTMAARLFCIFFALVGIPLNLVVLNRLGHLMQQGVNHWASRLGGTWQDPDKARWLAGSGALLSGLLLFLLLPPLLFSHMEGWSYTEGFYFAFITLSTVGFGDYVIGMNPSQRYPLWYKNMVSLWILFGMAWLALIIKLILSQLETPGRVCSCCHHSSKEDFKSQSWRQGPDREPESHSPQQGCYPEGPMGIIQHLEPSAHAAGCGKDS Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | 이름 | 세금 ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 748287 | KCNK17 | potassium two pore domain channel subfamily K member 17 | 9598 | VGNC:7898 | OMA, EggNOG |
| Macaque | 719574 | KCNK17 | potassium two pore domain channel subfamily K member 17 | 9544 | OMA, EggNOG | |
| Dog | 481781 | KCNK16 | potassium two pore domain channel subfamily K member 16 | 9615 | OMA, EggNOG | |
| Horse | 100065439 | KCNK17 | potassium two pore domain channel subfamily K member 17 | 9796 | VGNC:19295 | Inparanoid, OMA, EggNOG |
| Cow | 282264 | KCNK17 | potassium two pore domain channel subfamily K member 17 | 9913 | VGNC:30470 | Inparanoid, OMA, EggNOG |
| Pig | 106507367 | KCNK17 | potassium two pore domain channel subfamily K member 17 | 9823 | OMA, EggNOG | |
| Chicken | 421423 | KCNK17 | potassium two pore domain channel subfamily K member 17 | 9031 | CGNC:7653 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100564501 | kcnk17 | potassium two pore domain channel subfamily K member 17 | 28377 | Inparanoid, OMA |
Protein Classes
DTO Classes
protein / Ion channel / Two pore domain potassium channel family / Potassium channel subfamily K member 17
protein / Ion channel / Two pore domain potassium channel family / Potassium channel subfamily K member 17
Associated Recombinant Proteins
| 이름 | Specification and purity | Expression system | Protein label | 재고상태 | 자세히 보기 |
|---|
Associated Antibodies
| 이름 | Specifications | Species reactivity | 적용 | 재고상태 | 자세히 보기 |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| 이름 | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.