TNFRSF12A

설명Tumor necrosis factor receptor superfamily member 12A

Gene and Protein Information

Gene ID51330
Uniprot Accession IDs Q9NP84 D3DUA6 Q9HCS0
Ensembl ID ENSP00000326737
Symbol FN14 FN14 CD266 TWEAKR
Sequence
MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp107968771TNFRSF12ATNF receptor superfamily member 12A9598VGNC:5943OMA, EggNOG
Mouse27279Tnfrsf12atumor necrosis factor receptor superfamily, member 12a10090MGI:1351484Inparanoid, OMA, EggNOG
Rat302965Tnfrsf12aTNF receptor superfamily member 12A10116RGD:631329Inparanoid, OMA, EggNOG
Dog610734TNFRSF12ATNF receptor superfamily member 12A9615VGNC:47656Inparanoid, OMA, EggNOG
Horse100146755TNFRSF12ATNF receptor superfamily member 12A9796VGNC:24365Inparanoid, OMA, EggNOG
Cow617439TNFRSF12ATNF receptor superfamily member 12A9913VGNC:36162Inparanoid, OMA, EggNOG
Pig100217390TNFRSF12ATNF receptor superfamily member 12A9823Inparanoid, OMA, EggNOG
Opossum100017750TNFRSF12ATNF receptor superfamily member 12A13616Inparanoid, OMA, EggNOG
PlatypusTNFRSF12ATNF receptor superfamily member 12A [Source:HGNC Symbol;Acc:HGNC:18152]9258OMA, EggNOG

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.