🌎 Ship to: United States
Toggle Nav
Cart
검색
재고 상품은 당일 발송됩니다.
고급 검색
빠른 주문 SDS / CoA Structure 대량 및 사용자 정의
메뉴
계정
설정
྾
224,000+ 연구 제품 · Triple ISO certified · COA & SDS 모든 제품에 대한 사용 가능 · 주식 상품에 대한 같은 날 배송

GPR6

설명G-protein coupled receptor 6

Gene and Protein Information

Gene ID2830
Uniprot Accession IDs P46095 B4DHS9 J3KQR3 Q17RJ7 Q5SYL0
Ensembl ID ENSP00000406986
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MNASAASLNDSQVVVVAAEGAAAAATAAGGPDTGEWGPPAAAALGAGGGANGSLELSSQLSAGPPGLLLPAVNPWDVLLCVSGTVIAGENALVVALIASTPALRTPMFVLVGSLATADLLAGCGLILHFVFQYLVPSETVSLLTVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSRRTLLGVHLLLAATWTVSLGLGLLPVLGWNCLAERAACSVVRPLARSHVALLSAAFFMVFGIMLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGTLAVVLGTFGASWLPFAIYCVVGSHEDPAVYTYATLLPATYNSMINPIIYAFRNQEIQRALWLLLCGCFQSKVPFRSRSPSEV
Show more
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp104001079GPR6G protein-coupled receptor 69598VGNC:11087OMA, EggNOG
Macaque697979GPR6G protein-coupled receptor 69544Inparanoid, OMA, EggNOG
Mouse140741Gpr6G protein-coupled receptor 610090MGI:2155249Inparanoid, OMA, EggNOG
Rat83683Gpr6G protein-coupled receptor 610116RGD:70939Inparanoid, OMA, EggNOG
Dog481959GPR6G protein-coupled receptor 69615VGNC:41439Inparanoid, OMA, EggNOG
Cow506661GPR6G protein-coupled receptor 69913VGNC:29592Inparanoid, OMA, EggNOG
Pig100511485GPR6G protein-coupled receptor 69823OMA, EggNOG
Opossum100022066GPR6G protein-coupled receptor 613616Inparanoid, OMA, EggNOG
Chicken101747493GPR6G protein-coupled receptor 69031CGNC:72019Inparanoid, OMA
Anole lizard100563711gpr6G protein-coupled receptor 628377Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    G-protein coupled receptor 6
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    G-protein coupled receptor 6

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.