PTGER2

설명Prostaglandin E2 receptor EP2 subtype

Gene and Protein Information

Gene ID5732
Uniprot Accession IDs P43116 D3DSC0 Q52LG8 PGE receptor EP2 subtype
Ensembl ID ENSP00000245457
Symbol EP2
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGRRSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFSLATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQYCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGSGRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQALRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
Show more
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp467459PTGER2prostaglandin E receptor 29598VGNC:3332OMA, EggNOG
Macaque708024PTGER2prostaglandin E receptor 29544Inparanoid, OMA, EggNOG
Mouse19217Ptger2prostaglandin E receptor 2 (subtype EP2)10090MGI:97794Inparanoid, OMA, EggNOG
Rat81752Ptger2prostaglandin E receptor 210116RGD:620020Inparanoid, OMA, EggNOG
Dog403797PTGER2prostaglandin E receptor 29615VGNC:45143Inparanoid, OMA, EggNOG
Horse100067279PTGER2prostaglandin E receptor 29796VGNC:21987Inparanoid, OMA, EggNOG
Cow282329PTGER2prostaglandin E receptor 29913VGNC:33502Inparanoid, OMA, EggNOG
PigPTGER2prostaglandin E receptor 2 [Source:HGNC Symbol;Acc:HGNC:9594]9823OMA, EggNOG
Opossum100015803PTGER2prostaglandin E receptor 213616Inparanoid, EggNOG
PlatypusPTGER2prostaglandin E receptor 2 [Source:HGNC Symbol;Acc:HGNC:9594]9258OMA, EggNOG
Anole lizardPTGER2prostaglandin E receptor 2 [Source:HGNC Symbol;Acc:HGNC:9594]28377Inparanoid, OMA, EggNOG
Xenopus100493226ptger2prostaglandin E receptor 28364XB-GENE-967341Inparanoid, OMA, EggNOG
Zebrafish570410ptger2bprostaglandin E receptor 2b (subtype EP2)7955ZDB-GENE-040724-267Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Prostaglandin E2 receptor EP2 subtype
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Prostaglandin E2 receptor EP2 subtype

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.