for sensitive chromatographic and analytical workflows requiring minimal baseline interference.
🌡
Storage & shipping
Store at -20°C,Desiccated Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.
📋
Quality documents
SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.
📚
Literature proof
Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.
Specifications
Product Name
Apelin-36 (rat, mouse), CAS No.230299-95-3
Biochemische und physiologische Mechanismen
Endogenous APJ receptor agonist that is secreted by adipocytes. Binds with high affinity to APJ receptors (IC50= 5.4 nM) and potently inhibits cAMP productionin vitro(EC50= 0.52 nM). Involved in regulation of cardiovascular function, fluid homeostasis and
Sequenz
LVKPRTSRTGPGAWQGGRRKFRRQRPRLSHKGPMPF
Aktionsart
INHIBITOR
CAS
230299-95-3
Molekültyp
Kleines Molekül
Lagerung und Versand
Storage
Store at -20°C,Desiccated
Verschickt in
Ice chest + Ice pads
Documentation
📋 Safety Data Sheet (SDS)
Comprehensive hazard, handling, storage, and regulatory compliance document.
Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.
Shall we send you a message when we have discounts available?
Remind me later
Thank you! Please check your email inbox to confirm.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
