Mambalgin 1 TFA, CAS No.1609937-15-6

CAS: 1609937-15-6 Cat. No.: M287751 Summenformel: C₂₇₂H₄₂₉N₈₅O₈₄S₁₀• XCF₃COOH Molekulargewicht: 6554.54（free basis） PubChem CID: 121513904

GRADE & PURITY ≥95%

Specifications

Product Name

Mambalgin 1 TFA, CAS No.1609937-15-6

Spezifikationen & Reinheit

≥95%

Biochemische und physiologische Mechanismen

Selective ASIC1a inhibitor (IC50values are 192 and 72 nM for human ASIC1a and ASIC1a/1b dimer, respectively). Binds to closed/inactive channel. Selective for ASIC1a over ASIC2a, ASIC3, TRPV1, P2X2, 5-HT3, Nav1.8, Cav3.2 and Kv1.2 channels. Increases late

Sequenz

LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK (Disulfide bridge:Cys3-Cys19;Cys12-Cys37;Cys41-Cys49;Cys50-Cys55)

Aktionsart

INHIBITOR

CAS

1609937-15-6

Molekültyp

Peptide

Lagerung und Versand

Storage

Store at -20°C

Verschickt in

Ice chest + Ice pads

Application Protocols

No tested application protocols, recommended dilutions, or specific assay conditions are provided in the Product Data for this item.

General suggestions (non-validated, for planning only):

• Establish preliminary dose–response ranges based on literature for related mambalgin-1 preparations, then refine empirically for your cell line or expression system.
• Maintain strict pH control and include appropriate vehicle controls.

For validated protocols and lot-specific guidance, refer to the CoA/Spec Sheet or contact technical support with your intended application.

Biological Roles

General/literature overview for the Mambalgin-1 peptide family:

• Origin: Peptide toxin component of mamba snake venom, belonging to the three-finger toxin superfamily.
• Molecular function: Binds and modulates acid-sensing ion channels (ASICs) in vertebrates (literature). This interaction is widely used as a probe for ion channel physiology.
• Structural hallmarks: Compact fold stabilized by multiple disulfide bonds; looped “three-finger” topology confers high-affinity, subtype-sensitive interactions with target ion channels (literature).
• Research significance: Tool for dissecting ASIC subunit pharmacology, pH gating, and extracellular domain dynamics; benchmark in comparative studies with other ASIC ligands (e.g., PcTx1) (literature).

Caveats:

• Exact potency, subtype selectivity, and sequence for this specific item are not provided here and may vary by manufacturer/process; consult CoA/Spec Sheet.
• No clinical or diagnostic use is intended; for research use only (per Product Data).

Buffer Applications

Applicability: As a peptide ligand, this product is prepared and used in aqueous buffers rather than serving as a buffering agent itself.

General preparation guidance (peptide practice):

• Stock solutions: Dissolve in water or buffer. If needed, pre-wet with a minimal volume of DMSO, then bring to volume with buffer. Typical working buffers include PBS (pH ~7.2–7.4) or HEPES (10–20 mM, pH 7.4).
• pH control: ASIC-related assays are highly pH-sensitive; use calibrated pH meters and gas-tight mixing to avoid CO2-induced drift. Prepare acidified challenge solutions freshly and verify pH at assay temperature (literature).
• Additives: 0.1% BSA or similar carrier can reduce nonspecific adsorption at low nanomolar concentrations.
• Sterilization: For cell-based assays, sterile-filter through a 0.22 µm low-protein-binding membrane.

Not specified for this item: Recommended buffer composition and concentration for this exact SKU are not provided; consult CoA/Spec Sheet and optimize empirically for your assay.

Green Alternatives

Context: The active entity is a peptide; the “TFA” denotes the trifluoroacetate counterion. While TFA is industry-standard for peptide purification, it is a persistent, fluorinated acid with environmental considerations.

Greener considerations (general):

• Alternative counterions: Exchange TFA for acetate or chloride via desalting/ion-exchange if downstream assays or environmental policies discourage TFA.
• Formulation solvents: Favor water/buffer vehicles over high volumes of organic co-solvents (e.g., DMSO) to minimize solvent burden.

Comparison (general guidance):

• TFA salt vs. acetate/chloride salt:
  • Environmental impact: TFA > Acetate/Chloride (acetate/chloride are greener).
  • MS compatibility: Acetate/Chloride often superior for positive-mode ESI; TFA can suppress signal.
  • Solubility: TFA salts often highly water-soluble; acetate/chloride typically comparable.
  • Availability: TFA is most common from RP-HPLC; exchanging adds a processing step.

Small decision table (general):

• If your workflow is MS-heavy or requires minimal halogenated waste → consider acetate/chloride exchange.
• If maximal aqueous solubility and immediate use are priorities → TFA salt is convenient.

Item-specific environmental metrics (residual TFA %, solvent residues) are not specified for this item; refer to CoA/Spec Sheet.

Pharmaceutical Uses

This product is designated for research use only. No pharmacopeial grade, excipient role, or clinical formulation status is provided.

Context (general information for peptides):

• Research-grade peptides like Mambalgin-1 are sometimes evaluated in preclinical models as tool compounds, but they are not manufactured to GMP or pharmacopeial monographs unless explicitly stated.
• TFA counterion is common in research peptides but is typically avoided or exchanged in clinical formulations due to regulatory and analytical considerations.

Item-specific details:

• Pharmacopeia status, excipient roles, or GMP compliance: Not specified for this item; refer to CoA/Spec Sheet.

No medical or therapeutic claims are made or implied.

Physical Properties

Item-specific physical data:

• Appearance: Not specified for this item; refer to CoA/Spec Sheet.
• Molecular Weight: Not specified for this item; refer to CoA/Spec Sheet.
• Molecular Formula: Not specified for this item; refer to CoA/Spec Sheet.

General/literature expectations for a Mambalgin-1 peptide TFA salt:

• State: Solid (typically lyophilized powder or film), hygroscopic tendencies possible for peptide TFA salts.
• Solubility: High water affinity when in TFA salt form; often soluble in water, dilute acids, or buffers near neutral pH; may require small amounts of DMSO for first dissolution depending on sequence (literature, general peptide behavior).
• pI/pKa: Sequence-dependent; not specified for this item. Peptide ionization is governed by side-chain composition (literature).
• LogP: Not applicable/relevant for large peptides; distribution is dominated by charge and hydrogen bonding (general).
• Optical rotation/UV: Peptides exhibit strong UV at 214 nm and 280 nm if aromatic residues are present; exact extinction coefficient is sequence-dependent (literature).
• Thermal behavior: No sharp melting point; peptides typically degrade before melting; avoid prolonged elevated temperatures (general).

Important: For assays that require accurate concentration by UV, obtain the exact sequence and extinction coefficient from the CoA/Spec Sheet or calculate from sequence (literature-based calculation).

Quality and Grades

Item-specific quality information:

• Grade/Purity: Not specified for this item; refer to CoA/Spec Sheet.

Interpretation and context (general for research peptides):

• Peptide quality metrics: Commonly reported as percentage purity by HPLC (area %) and supported by mass verification (ESI/LC–MS or MALDI). If applicable, disulfide connectivity and counterion content (TFA %) may also be reported.
• Implications of TFA salt: Trifluoroacetate is a standard counterion from RP-HPLC purification. Trace TFA can influence cell-based assays and MS ionization. If counterion is critical, consider ion-exchange to acetate or chloride (see Green Alternatives) or request counterion analysis in the CoA.
• Endotoxin/bioburden: Not typically specified for standard research peptides unless noted. For cell work, users may perform additional sterile filtration or endotoxin testing as needed.
• Batch documentation: For rigorous applications, consult the CoA for sequence confirmation, exact molecular weight (monoisotopic/average), purity, residual solvents, and water content if tested.

Recommendation: Verify that the quality metrics in the CoA/Spec Sheet (when provided) meet your assay tolerance (e.g., ≥95% HPLC purity for electrophysiology vs. lower thresholds for screening).

Reaction and Applications

This item is a bioactive peptide used as a research tool rather than a reagent for synthetic organic reactions.

Research applications (general/literature for Mambalgin-1 family):

• Ion channel pharmacology: Employed as a selective modulator/ligand of acid-sensing ion channels (ASICs) in electrophysiological recordings and binding studies (literature). Useful for characterizing subunit contributions, desensitization kinetics, and pH-dependence in heterologous expression systems.
• Chemical biology: Serves as a reference standard in structure–activity studies, disulfide mapping, and comparison to analogs or engineered variants.
• Assay development: Utilized to validate assay windows in fluorescence-based membrane potential assays or automated patch clamp (literature/general practice).

Practical tips (general):

• Prepare concentrated stock in water or compatible buffer; aliquot to avoid freeze–thaw.
• Include carrier proteins (e.g., 0.1% BSA) to reduce adsorption losses for very dilute working solutions (typical peptide handling).
• For electrophysiology, pre-equilibrate solutions and control pH precisely; even small pH shifts can affect ASIC gating and apparent potency (literature).

Note: Manufacturer-provided application notes for this specific SKU are not supplied. Users should establish conditions empirically for their system.

Reaction Conditions

This product is not intended for use as a reagent in chemical reactions. The most relevant “conditions” pertain to its handling and use in biological assays.

General guidance (literature/practice for peptide ligands):

• Working temperature: Keep on ice during assay setup; equilibrate to assay temperature (e.g., 20–25°C or 32–37°C) before application to biological systems to prevent thermal shock.
• pH control: For ASIC-related experiments, solution pH is critical; use freshly prepared buffers and verify pH at the working temperature.
• Light/oxidation: Protect from excessive light and oxidative conditions; peptides with disulfides can undergo scrambling under basic or reducing environments.
• Timescales: Equilibration and wash-in/out times depend on assay (seconds to minutes in electrophysiology). Determine empirically for your setup.

Item-specific recommended concentrations, vehicles, or incubation times are not specified; consult CoA/Spec Sheet and optimize in pilot experiments.

Safety and Handling

GHS and hazard data (item-specific):

• Signal Word: Not specified for this item; refer to SDS.
• Hazard Statements (H-Statements): Not specified for this item; refer to SDS.
• GHS Classification/Pictograms: Not specified for this item; refer to SDS.

General laboratory safety for peptide TFA salts:

• PPE: Lab coat, nitrile gloves, and safety glasses. Use appropriate containment to avoid aerosolization during weighing and resuspension.
• Handling: Minimize dust formation. Reconstitute gently to prevent foaming. TFA counterions can confer acidity; avoid contact with skin/eyes.
• Engineering controls: Work in a clean area; for large-scale or aerosol-prone steps, use a chemical fume hood or biosafety cabinet as institutional policy dictates.
• Incompatibilities: Strong oxidizers; strong bases may promote peptide backbone/side-chain degradation. Avoid prolonged exposure to elevated temperature and light.
• First aid (general): If inhaled: move to fresh air. Skin/eye contact: rinse with water for several minutes; remove contaminated clothing. If ingested: rinse mouth. Seek medical attention as per SDS.
• Waste: Dispose of aqueous peptide solutions and TFA-containing wastes per institutional hazardous chemical protocols.

Note: Always consult the product-specific SDS for authoritative hazard classification and first-aid measures. No medical or clinical use is intended; for research use only.

Solvent Selection

Applicability: This product is a peptide TFA salt rather than a traditional organic solvent. Solvent choice discussed here refers to reconstitution and working solutions.

General guidance (literature/general peptide practice):

• Primary solvents: Water or aqueous buffers (e.g., PBS, HEPES) are preferred. The TFA salt form typically improves water solubility.
• Co-solvents: If initial dissolution is challenging, use minimal DMSO (e.g., 2–10% v/v) to wet the peptide, then dilute into buffer. Alternatively, add a small volume of dilute acid (e.g., 0.1% acetic acid) to protonate basic residues before aqueous dilution.
• pH effects: Maintain near-neutral pH after dilution to preserve peptide integrity and biological activity; avoid strong base, which can induce deamidation or disulfide scrambling.
• Filtration: Use low-protein-binding membranes (PVDF, PES, PTFE) for sterile filtration.

Comparison (general):

• Water/buffer: Biocompatible, ideal for bioassays; may require gentle warming/sonication.
• DMSO: Enhances initial solubilization; keep final DMSO low to reduce effects on cells or channels.
• Dilute acids (acetic acid): Useful for stock solutions but adjust to physiological pH before biological testing.

Note: Exact solubility and recommended vehicle for this specific item are not specified; consult the CoA/Spec Sheet and pilot small-scale dissolutions.

Storage and Reconstitution

Item-specific storage and shipping:

• Storage Conditions: Store at -20°C (from Product Data). Protect from moisture and light.
• Shipped In: Ice chest + Ice pads (from Product Data).
• Research Use Note: For research use only (from Product Data).

General reconstitution guidance for peptide TFA salts:

• Solvent selection: Start with ultrapure water or buffer (e.g., PBS, HEPES). If needed, first wet with minimal DMSO or a small volume of dilute acid (e.g., 0.1% acetic acid), then dilute with buffer to desired concentration.
• Concentration: Prepare a concentrated stock (e.g., 0.1–1 mM if solubility permits), then make working dilutions freshly.
• Aliquoting: Divide into single-use aliquots to avoid repeated freeze–thaw cycles, which can degrade peptides and reduce activity.
• Stability: Short-term (hours to a day) at 2–8°C after thaw is typical; for longer storage, keep frozen at -20°C or below. Avoid prolonged exposure to basic pH and elevated temperatures.
• Sterility: If using in cell-based assays, sterile-filter reconstituted solutions with a 0.22 µm low-protein-binding filter.

Note: Exact solubility limits, stability data, and buffer compatibility for this specific SKU are not specified; refer to the CoA/Spec Sheet for any lot-specific recommendations.

Structure and Identity

Brief: Mambalgin 1 TFA is a peptide toxin (TFA salt) commonly used as a research tool in ion channel biology.

Item-specific identifiers (from Product Data):

• Product Name: Mambalgin 1 TFA (TFA = trifluoroacetate counterion)
• CAS: 1609937-15-6
• CID: 121513904
• InChIKey: 168376
• SMILES: Not specified for this item; refer to CoA/Spec Sheet.
• Molecular Formula: Not specified for this item; refer to CoA/Spec Sheet.
• Molecular Weight: Not specified for this item; refer to CoA/Spec Sheet.

Structural features (general/literature description of Mambalgin-1 peptide):

• Biopolymer class: Peptide toxin (three-finger toxin family) isolated from mamba venom; typically ~57 amino acids with multiple disulfide bonds (literature).
• Counterion: Trifluoroacetate (TFA) associated with peptide backbone amines following RP-HPLC purification (general practice).
• 2D description in words: A single polypeptide chain with several looped regions stabilized by disulfide bridges; side chains include basic (Lys/Arg), acidic (Asp/Glu), polar (Ser/Thr), and hydrophobic residues (literature, general peptide composition for this family). Stereochemistry is L-amino acid at each residue (naturally occurring peptides).

Notes:

• Exact sequence, modifications, and disulfide connectivity for this specific lot/formulation are not provided here; consult the CoA/Spec Sheet for definitive structural details.

Synthetic Utility

Not a general-purpose synthetic reagent. As a folded, disulfide-rich peptide, Mambalgin 1 TFA is primarily a biological probe rather than a building block.

General notes (peptide chemistry perspective):

• Reference standard: Can serve as a standard for analytical method development (HPLC retention, MS confirmation) in peptide synthesis and folding studies.
• Comparative benchmarking: Useful for validating folding protocols for three-finger toxin mimetics or for SAR studies against ASICs (literature).
• Derivatization: Site-specific labeling (e.g., with fluorescent tags) may be feasible depending on sequence and available residues, but such modifications require dedicated chemistries and are not part of this product listing.

Item-specific synthetic parameters (functional group counts, sequence, protecting group history) are not provided; consult CoA/Spec Sheet if needed.

Target Specificity

Item-specific target data are not provided in the Product Data for this SKU.

No antigen/epitope, clone, isotype, or species reactivity information applies here, as this is a peptide reagent (not an antibody). For biological target interactions or potency values, consult the primary literature and the product CoA/Spec Sheet if available.