The store will not work correctly when cookies are disabled.
JavaScript scheint in Ihrem Browser deaktiviert zu sein. Um unsere Website in bester Weise zu erfahren, aktivieren Sie Javascript in Ihrem Browser.
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager Oxyntomodulin TFA, CAS No.62340-29-8(free base) 🧪
Why this grade ≥97% for sensitive chromatographic and analytical workflows requiring minimal baseline interference.
🌡
Storage & shipping Store at -20°C,Desiccated Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.
📋
Quality documents SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.
📚
Literature proof Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.
Übersicht Oxyntomodulin TFA, a 37-amino acid peptide hormone, is a Glukagon-like peptide 1 (GLP-1) receptor agonist.
Specifications Product Name
Oxyntomodulin TFA, CAS No.62340-29-8(free base)
Synonyme
Glucagon (1-37)(TFA) | Enteroglucagon(TFA)
Spezifikationen & Reinheit
≥97%
Sequenz
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
Lagerung und Versand Storage
Store at -20°C,Desiccated
Verschickt in
Ice chest + Ice pads
Documentation 📋 Safety Data Sheet (SDS) Comprehensive hazard, handling, storage, and regulatory compliance document.
Download SDS → ✅ Certificate of Analysis (COA) Lot-specific quality data. Enter your lot number to retrieve the exact COA.
Look up COA → 📊 Datasheet Quick-reference summary of product specifications and applications.
View datasheet → 🔬 Specification Sheet Full quality attributes and acceptance criteria for this grade.
View spec sheet →
Advanced Data Zertifikate (CoA, COO, BSE/TSE und Analyse-Diagramm) Lösungsrechner Molarity Calculator Determine the necessary mass, volume, or concentration for preparing a solution.
Dilution Calculator Determine the dilution needed to prepare a stock solution.
Reconstitution Calculator Bewertungen
Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer
Cookie-Richtlinie. Einstellungen Alle zustimmen Ablehnen
Shall we send you a message when we have discounts available?
Remind me later Erlauben
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.