Determine the necessary mass, volume, or concentration for preparing a solution.
Oxyntomodulin TFA, CAS No.62340-29-8(free base)
Zu bestellen verfügbar
GRADE & PURITY ≥97%
🌎 Ship to: United States
Navigation umschalten 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
Why this grade
≥97% for sensitive chromatographic and analytical workflows requiring minimal baseline interference.
Storage & shipping
Store at -20°C,Desiccated Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.
Quality documents
SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.
Literature proof
Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.
Übersicht
Oxyntomodulin TFA, a 37-amino acid peptide hormone, is a Glukagon-like peptide 1 (GLP-1) receptor agonist.
Specifications
Product Name
Oxyntomodulin TFA, CAS No.62340-29-8(free base)
Synonyme
Glucagon (1-37)（TFA） | Enteroglucagon（TFA）
Spezifikationen & Reinheit
≥97%
Sequenz
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
CAS
62340-29-8(free base)
Molekültyp
Peptide
Lagerung und Versand
Storage
Store at -20°C,Desiccated
Verschickt in
Ice chest + Ice pads
Documentation
📋 Safety Data Sheet (SDS)
Comprehensive hazard, handling, storage, and regulatory compliance document.
Download SDS →✅ Certificate of Analysis (COA)
Lot-specific quality data. Enter your lot number to retrieve the exact COA.
Look up COA →🔬 Specification Sheet
Full quality attributes and acceptance criteria for this grade.
View spec sheet →Advanced Data
Zertifikate (CoA, COO, BSE/TSE und Analyse-Diagramm)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Datum | Artikel |
|---|---|---|---|
 C23281113 | Certificate of Analysis | Jan 07, 2023 | O287276 |
| C23281114 | Certificate of Analysis | Jan 07, 2023 | O287276 |
| C23281115 | Certificate of Analysis | Jan 07, 2023 | O287276 |
| C23281121 | Certificate of Analysis | Jan 07, 2023 | O287276 |
| C2329405 | Certificate of Analysis | Jan 07, 2023 | O287276 |
| C2329472 | Certificate of Analysis | Jan 07, 2023 | O287276 |
Lösungsrechner
Bewertungen
Kundenbewertungen
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.