Recombinant Human BCAM Protein

Cat. No.: rp143897
Zu bestellen verfügbar
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE)
Accession #
CAA58449.1
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of TE‑85 human osteogenic sarcoma cells. The ED50 for this effect is 0.250-3.00 μg/mL.
★
Size
Deutschland (EU)
USA*
Price
Qty
10μg
rp143897-10μg
—
9 Auf Lager
121,40€
50μg
rp143897-50μg
—
3 Auf Lager
237,67€
100μg
rp143897-100μg
—
1 Auf Lager
381,72€
1mg
rp143897-1mg
Auf Bestellung · 8–12 Wochen
1.856,87€
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His-Tag,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human BCAM Protein
Synonyme
Auberger B antigen | B-CAM cell surface glycoprotein | F8/G253 antigen | Lutheran antigen | Lutheran blood group glycoprotein | antigen identified by monoclonal F8 | Auberger B antigen | basal cell adhesion molecule (Lu and Au blood groups) | basal cell a
Note
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, His Tag
Spezifikationen & Reinheit
Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His-Tag,≥95%(SDS-PAGE)
Biochemische und physiologische Mechanismen
Laminin alpha-5 receptor. May mediate intracellular signaling.
Bioaktivität
Measured by the ability of the immobilized protein to support the adhesion of TE‑85 human osteogenic sarcoma cells. The ED50 for this effect is 0.250-3.00 μg/mL.
Endotoxin-Konzentration
<0.1 EU/μg
Expression System
HEK293
Arten
Human
Aminosäuren
32-547 aa
Sequenz
EVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGAAGTAEATARLNVFAKPEATEVSPNKGTLSVMEDSAQEIATCNSRNGNPAPKITWYRNGQRLEVPVEMNPEGYMTSRTVREASGLLSLTSTLYLRLRKDDRDASFHCAAHYSLPEGRHGRLDSPTFHLTLHYPTEHVQFWVGSPSTPAGWVREGDTVQLLCRGDGSPSPEYTLFRLQDEQEEVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQGSPELKTAEIEPKADGSWREGDEVTLICSARGHPDPKLSWSQLGGSPAEPIPGRQGWVSSSLTLKVTSALSRDGISCEASNPHGNKRHVFHFGAVSPQTSQAHHHHHH
Protein Tag
C-His
Beitritt #
Voraussichtliches Molekulargewicht
57 kDa
SDS-PAGE
70 - 82 kDa, under reducing conditions; 63 - 75 kDa, under non-reducing conditions.
Molekültyp
Protein
Lagerung und Versand
Form
Lyophilized
Rekonstitution
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Verschickt in
Ice chest + Ice pads
Stabilität und Lagerung
Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Bilder

Recombinant Human BCAM Protein (rp143897) - SDS-PAGE
2 μg/lane of Recombinant Human BCAM Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 70 - 82 kDa under reducing condition and 63 - 75 kDa under non-reducing condition.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Zugehörige Ziele (menschlich)
BCAM Tbio Basal cell adhesion molecule (0 Activities)
Activity TypeActivity Value -log(M)Mechanism of ActionActivity ReferencePublications (PubMed IDs)
Zertifikate (CoA, COO, BSE/TSE und Analyse-Diagramm)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDatumArtikel
ZJ25F0420254Certificate of AnalysisFeb 24, 2026 rp143897
ZJ25F0420255Certificate of AnalysisFeb 24, 2026 rp143897
ZJ25F0420256Certificate of AnalysisFeb 24, 2026 rp143897
Lösungsrechner
Bewertungen

Kundenbewertungen

Häufig gestellte Fragen

What is the purity of this product, and how is it determined?
This product is supplied at ≥95% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.
What does Animal Free mean?
Animal Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
How should this product be stored?
Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.
What does Carrier Free mean?
Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
How is this product shipped?
This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.
What documentation is provided?
Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.