Recombinant Human CDX2 Protein

Cat. No.: rp214416

QUALITÄT & REINHEIT Carrier Free, His Tag, ≥85%(SDS-PAGE), See COA

Accession #

Q99626

Protein Tag

N-His

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Spezifikationen

Product Name

Recombinant Human CDX2 Protein

Synonyme

Caudal type homeo box 2 | Caudal type homeo box transcription factor 2 | Caudal type homeobox 2 | Caudal type homeobox protein 2 | Caudal type homeobox transcription factor 2 | Caudal-type homeobox protein 2 | CDX 2 | CDX 3 | CDX-3 | Cdx2 | CDX2/AS | CDX2

Note

Carrier Free, His Tag

Spezifikationen & Reinheit

Carrier Free,His-Tag,≥85%(SDS-PAGE),See COA

Biochemische und physiologische Mechanismen

Involved in the transcriptional regulation of multiple genes expressed in the intestinal epithelium. Important in broad range of functions from early differentiation to maintenance of the intestinal epithelial lining of both the small and large intestine.

Endotoxin-Konzentration

<1.0 EU/μg

Aminosäuren

54-249 aa

Sequenz

MHHHHHHNLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKL

Beitritt #

Q99626

Voraussichtliches Molekulargewicht

22.4 kDa

SDS-PAGE

26.1 & 47.2 & 50.7 kDa, under reducing conditions; 25.3 & 26.6 & 45.7 & 50.9 kDa, under non-reducing conditions.

Molekültyp

Protein

Product Line

Biologische Produkte

Lagerung und Versand

Konzentration

See COA

Rekonstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Storage

Store at -20°C,Avoid repeated freezing and thawing

Verschickt in

Ice chest + Ice pads

Stabilität und Lagerung

Store at -20℃ for 6 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.

Bilder

SDS-PAGE: Recombinant Human CDX2 Protein (rp214416)

Recombinant Human CDX2 Protein (rp214416) - SDS-PAGE
3 μg/lane of Recombinant Human CDX2 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 26.1 & 47.2 & 50.7 kDa under reducing conditions and 25.3 & 26.6 & 45.7 & 50.9 kDa under non-reducing conditions.
CDX2 binds as a dimer to its regulatory element and that dimerization in vitro is dependent on redox potential (PMID: 7935448).

Häufig gestellte Fragen

What is the purity of this product, and how is it determined?

This product is supplied at ≥85% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.

What does Carrier Free mean?

Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.

What is His Tag?

His Tag refers to a recombinant protein product fused with the His affinity tag, suitable for recombinant protein expression and affinity purification. The tag enables one-step affinity purification, immobilization or detection without affecting downstream activity in most cases.

How should this product be stored?

Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.

How is this product shipped?

This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.

What documentation is provided?

Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.