Recombinant Human CXCL5 Protein, >97% (SDS-PAGE, HPLC)

Cat. No.: rp144864
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥97%(SDS-PAGE&HPLC)
Expression System
E.coli
Accession #
P42830
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood neutrophils is in a concentration of 10.0-100.0 ng/ml.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp144864-10μg
2
$99.90
50μg
rp144864-50μg
1
$339.90
100μg
rp144864-100μg
1
$539.90
1mg
rp144864-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$3,199.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,PBS Only,≥97%(SDS-PAGE&HPLC) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,High Performance,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Purity

>97% SDS-PAGE or HPLC analyses. Endotoxin level is Less than 0.1EU/µg .


Function

Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chemotactic activity for neutrophil granulocytes.


Post-translational

N-terminal processed forms ENA-78(8-78) and ENA-78(9-78) are produced by proteolytic cleavage after secretion from peripheral blood monocytes.


CXCL5 is a small cytokine also known as epithelial-derived neutrophil-activating peptide 78 (ENA-78). The protein is produced following stimulation of cells with the inflammatory cytokine interleukin-1 or tumor necrosis factor-alpha. In vitro, ENA-78 (8-78) and ENA-78 (9-78) show a threefold higher chemotactic activity for neutrophil granulocytes. They are produced by proteolytic cleavage after secretion from peripheral blood monocytes. Recombinant human CXCL5 (5-78 a.a.) contains 74 amino acids and it is a single non-glycosylated polypeptide chain. Human CXCL5 shares 57% amino acid sequence identity with mouse and rat CXCL5. Recombinant Human ENA-78/CXCL5 is an 8.1kDa protein containing 74 amino acid residues.


 

Specifications

Product Name
Recombinant Human CXCL5 Protein, >97% (SDS-PAGE, HPLC)
Synonyms
chemokine (C-C motif) ligand 5 | C-X-C motif chemokine 5 | CXCL5 | CXCL5/ENA-78 | ENA78 | ENA-78 | ENA-78(1-78) | Epithelial-derived neutrophil-activating protein 78 | Neutrophil-activating peptide ENA-78 | neutrophil-activating protein 78 | SCYB5ENA78 |
Grade
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance, PBS Only
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, PBS Only, ≥97%(SDS-PAGE&HPLC)
Purity
>97% (SDS-PAGE, HPLC)
Bioactivity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood neutrophils is in a concentration of 10.0-100.0 ng/ml.
Endotoxin Concentration
<0.1 EU/μg
Expression System
E.coli
Species
Human
Amino Acids
41-114 aa
Sequence
AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
Protein Tag
No tag
Accession #
Predicted molecular weight
8.1 kDa
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in a sterile aqueous buffer to an appropriate concentration. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Upon receipt, it is recommended to aliquot. Store at -20°C, Avoid freeze / thaw cycles.
Images

Recombinant Human CXCL5 Protein ( rp144864) - Protein Bioactivity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood neutrophils is in a concentration of 10.0-100.0 ng/mL.

Recombinant Human CXCL5 Protein ( rp144864) - SDS-PAGE
2.5 μg/lane of Recombinant Human CXCL5 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 9.4 kDa under reducing conditions and 12.0 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ23F0901074Certificate of AnalysisMar 20, 2026 rp144864
ZJ23F0901072Certificate of AnalysisFeb 10, 2026 rp144864
ZJ23F0901073Certificate of AnalysisFeb 10, 2026 rp144864
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.