Recombinant Human CXCL9 Protein, >97% (SDS-PAGE)

Cat. No.: rp144872
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. ≥97%(SDS-PAGE&HPLC)
Expression System
E.coli
Accession #
Q07325
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<0.01 EU/μg
Bioactivity
Measured by its ability to chemoattract BaF3 mouse pro‑B cells transfected with mouse CXCR3. The ED₅₀ for this effect is 0.1‑0.4 µg/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp144872-10μg
3
$79.90
50μg
rp144872-50μg
3
$329.90
100μg
rp144872-100μg
1
$599.90
1mg
rp144872-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$5,199.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥97%(SDS-PAGE&HPLC) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,High Performance for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Purity

>97% SDS-PAGE. Purity is greater than 97% as determined by reducing SDS-PAGE


Function

Cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response. Chemotactic for activated T-cells. Binds to CXCR3.


CXCL9, a member of the alpha  subfamily of chemokines that lack the ELR domain, was initially identified as a lymphokine-activated gene in mouse macrophages. Human CXCL9 was subsequently cloned using mouse MIG cDNA as a probe. The CXCL9 gene is induced in macrophages and in primary glial cells of the central nervous system specifically in response to IFN-gamma. CXCL9 has been shown to be a chemoattractant for activated T‑lymphocytes and TIL but not for neutrophils or monocytes. The human CXCL9 cDNA encodes a 125 amino acid residue precursor protein with a 22 amino acid residue signal peptide that is cleaved to yield a 103 amino acid residue mature protein. CXCL9 has an extended carboxy‑terminus containing greater than 50% basic amino acid residues and is larger than most other chemokines. The carboxy‑terminal residues of CXCL9 are prone to proteolytic cleavage resulting in size heterogeneity of natural and recombinant CXCL9. CXCL9 with large carboxy‑terminal deletions have been shown to have diminished activity in the calcium flux assay. A chemokine receptor (CXCR3) specific for CXCL9 and IP-10 has been cloned and shown to be highly expressed in IL-2-activated T‑lymphocytes. The E. coli‑expressed CXCL9 preparations produced at R&D Systems have been shown to contain greater than 80% full length CXCL9.

Specifications

Product Name
Recombinant Human CXCL9 Protein, >97% (SDS-PAGE)
Synonyms
Chemokine (C-X-C motif) ligand 9 | CMK | crg-10 | C-X-C motif chemokine 9 | CXCL9 | Gamma-interferon-induced monokine | Humig | MIG | MIGSmall-inducible cytokine B9 | monokine induced by gamma interferon | SCYB9Monokine induced by interferon-gamma | Recom
Grade
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance
Specifications & Purity
ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥97%(SDS-PAGE&HPLC)
Purity
>97% (SDS-PAGE)
Bioactivity
Measured by its ability to chemoattract BaF3 mouse pro‑B cells transfected with mouse CXCR3. The ED₅₀ for this effect is 0.1‑0.4 µg/mL.
Endotoxin Concentration
<0.01 EU/μg
Expression System
E.coli
Species
Human
Amino Acids
23-125 aa
Sequence
TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
Protein Tag
No tag
Accession #
Predicted molecular weight
11.7 kDa
SDS-PAGE
16.8 kDa, under reducing conditions.
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
Reconstitute in sterile water , aliquot and store at -80°C for 12 months or +4°C for 1 week. Avoid repeated freeze-thaw.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Upon receipt, it is recommended to aliquot. Store at -20°C, Avoid freeze / thaw cycles. This product is an active protein and may elicit a biological response in vivo, handle with caution.
Images

Recombinant Human CXCL9 Protein (rp144872)-Protein Bioactivity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood T-lymphocytes is in a concentration range of 10-100 ng/mL.

Recombinant Human CXCL9 Protein (rp144872)-SDS-PAGE
Recombinant Human CXCL9 Protein was resolved with SDS-PAGE under reducing (R) and visualized by Coomassie® Blue staining, showing a single band at 16.8 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ23F0600385Certificate of AnalysisJun 17, 2026 rp144872
ZJ23F0600386Certificate of AnalysisJun 17, 2026 rp144872
ZJ23F0600387Certificate of AnalysisJun 17, 2026 rp144872
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.