Recombinant Human DBNDD2 Protein

Cat. No.: rp189367

QUALITÄT & REINHEIT Carrier Free, His Tag, ≥95%(SDS-PAGE), See COA

Accession #

Q9BQY9

Protein Tag

N-His

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Spezifikationen

Product Name

Recombinant Human DBNDD2 Protein

Synonyme

C20orf35 | Casein kinase-1 binding protein | CK1BP | DBND2_HUMAN | Dbndd2 | Dysbindin (dystrobrevin binding protein 1) domain containing 2 | Dysbindin domain-containing protein 2 | HSMNP1 | SCF apoptosis response protein 1

Note

Carrier Free, His Tag

Spezifikationen & Reinheit

Carrier Free,His-Tag,≥95%(SDS-PAGE),See COA

Biochemische und physiologische Mechanismen

May modulate the activity of casein kinase-1. Inhibits CSNK1D autophosphorylation (in vitro).

Endotoxin-Konzentration

<1.0 EU/μg

Aminosäuren

2-161 aa

Sequenz

MHHHHHHDPNPRAALERQQLRLRERQKFFEDILQPETEFVFPLSHLHLESQRPPIGSISSMEVNVDTLEQVELIDLGDPDAADVFLPCEDPPPTPQSSGMDNHLEELSLPVPTSDRTTSRTSSSSSSDSSTNLHSPNPSDDGADTPLAQSDEEEERGDGGAEPGACS

Beitritt #

Q9BQY9

Voraussichtliches Molekulargewicht

18.3 kDa

SDS-PAGE

28.5 kDa, under reducing conditions; 26.1 & 28.9 kDa, under non-reducing conditions.

Molekültyp

Protein

Product Line

Biologische Produkte

Lagerung und Versand

Konzentration

See COA

Storage

Store at -20°C,Avoid repeated freezing and thawing

Verschickt in

Ice chest + Ice pads

Stabilität und Lagerung

Store at -20℃ for 12 months. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.

Bilder

SDS-PAGE: Recombinant Human DBNDD2 Protein (rp189367)

Recombinant Human DBNDD2 Protein (rp189367) - SDS-PAGE
3 μg/lane of Recombinant Human DBNDD2 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 28.5 kDa under reducing conditions and 26.1 & 18.9 kDa under non-reducing conditions.
It is speculated that cysteine affects the non-reducing band, causing differences from the reducing band.

Häufig gestellte Fragen

What is the purity of this product, and how is it determined?

This product is supplied at ≥95% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.

What does Carrier Free mean?

Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.

What is His Tag?

His Tag refers to a recombinant protein product fused with the His affinity tag, suitable for recombinant protein expression and affinity purification. The tag enables one-step affinity purification, immobilization or detection without affecting downstream activity in most cases.

How should this product be stored?

Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.

What documentation is provided?

Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.

How is this product shipped?

This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.