Recombinant Human E-selectin/CD62E Protein

Cat. No.: rp217606

GRADE & PURITY Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, His Tag, PBS Only, ≥90%(SDS-PAGE), See COA

Accession #

P16581

Protein Tag

C-His

Expression system

HEK293

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. When 5 x 104 cells/well are added to human E-Selectin/Fc Chimera coated plates (1 µg/mL with 100 µL/well), approximately 90-100% will adhere after 2 hour incubation at RT.

Specifications

Product Name

Recombinant Human E-selectin/CD62E Protein

Synonyme

CD62 antigen-like family member E | CD62E antigen | CD62E | ELAM | ELAM1 | ELAM-1 | ELAM1E-selectin | endothelial adhesion molecule 1 | Endothelial leukocyte adhesion molecule 1 | ESEL | E-Selectin | LECAM2 | leukocyte endothelial cell adhesion molecule 2

Note

ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, His Tag, PBS Only

Spezifikationen & Reinheit

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His Tag,PBS Only,≥90%(SDS-PAGE),See COA

Biochemische und physiologische Mechanismen

E-Selectin (Endothelial Leukocyte Adhesion Molecule-1, ELAM-1, CD62E), a member of the Selectin family, is a 107 - 115 kDa cell surface glycoprotein. It is transiently expressed on vascular endothelial cells in response to IL-1 beta and TNF-alpha, and dem

Bioaktivität

Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. When 5 x 104 cells/well are added to human E-Selectin/Fc Chimera coated plates (1 µg/mL with 100 µL/well), approximately 90-100% will adhere after 2 hour incubation at RT.

Endotoxin-Konzentration

<1.0 EU/μg

Aminosäuren

1-230 aa

Sequenz

MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWHHHHHH

Beitritt #

P16581

Voraussichtliches Molekulargewicht

24.5 kDa

SDS-PAGE

33.0-40.0 kDa, under reducing conditions; 30.5-37.3 & 54.5-63.7 kDa, under non-reducing conditions.

Molekültyp

Protein

Product Line

Biologische Produkte

Lagerung und Versand

Konzentration

See COA

Rekonstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Storage

Store at -20°C,Avoid repeated freezing and thawing

Verschickt in

Ice chest + Ice pads

Stabilität und Lagerung

Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.

Bilder

Bioactivity: Recombinant Human E-selectin/CD62E Protein (rp217606)

Recombinant Human E-selectin/CD62E Protein (rp217606) - Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. When 5 x 104 cells/well are added to human E-Selectin/Fc Chimera coated plates (1 µg/mL with 100 µL/well), approximately 90-100% will adhere after 2 hour incubation at RT.

SDS-PAGE: Recombinant Human E-selectin/CD62E Protein (rp217606)

Recombinant Human E-selectin/CD62E Protein (rp217606) - SDS-PAGE
3 μg/lane of Recombinant Human E-selectin/CD62E Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 33.0-40.0 kDa under reducing conditions and 30.5-37.3 & 54.5-63.7 kDa under non-reducing conditions.
Under specific non-physiological conditions, including high concentrations or particular buffer environments, CD62E (E-selectin) may coexist as both monomers and dimers (Uniprot ID: P16581).

Häufig gestellte Fragen

What is the purity of this product, and how is it determined?

This product is supplied at ≥90% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.

What does Animal Free mean?

Animal Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.

What does Carrier Free mean?

Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.

How should this product be stored?

Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.

How is this product shipped?

This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.

What documentation is provided?

Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.