Recombinant Human MASP3 Protein

Cat. No.: rp229167

GRADE & PURITY Animal Free, Carrier Free, His Tag, ≥95%(SDS-PAGE), expressed in HEK293; See COA

Accession #

P48740

Protein Tag

C-10His

Expression system

HEK293

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Testing in progress

Specifications

Product Name

Recombinant Human MASP3 Protein

Note

Animal Free, Carrier Free, His Tag

Spezifikationen & Reinheit

Animal Free,Carrier Free,His Tag,≥95%(SDS-PAGE),expressed in HEK293; See COA

Biochemische und physiologische Mechanismen

MASP3 is a member of the MASPs involved in mannan-binding lectin (MBL) complement pathway. The MBL pathway is initiated by the binding of MBL to specific carbohydrate structures found on the surface of a variety of microorganisms. Activation of the comple

Bioaktivität

Testing in progress

Endotoxin-Konzentration

<1.0 EU/μg

Aminosäuren

450-721 aa

Sequenz

IIGGRNAEPGLFPWQALIVVEDTSRVPNDKWFGSGALLSASWILTAAHVLRSQRRDTTVIPVSKEHVTVYLGLHDVRDKSGAVNSSAARVVLHPDFNIQNYNHDIALVQLQEPVPLGPHVMPVCLPRLEPEGPAPHMLGLVAGWGISNPNVTVDEIISSGTRTLSDVLQYVKLPVVPHAECKTSYESRSGNYSVTENMFCAGYYEGGKDTCLGDSGGAFVIFDDLSQRWVVQGLVSWGGPEECGSKQVYGVYTKVSNYVDWVWEQMGLPQSVHHHHHHHHHH

Beitritt #

P48740

Voraussichtliches Molekulargewicht

33.0 kDa

SDS-PAGE

38.2-45.9 kDa, under reducing conditions; 39.3-44.5 kDa, under non-reducing conditions.

Molekültyp

Protein

Product Line

Biologische Produkte

Lagerung und Versand

Konzentration

expressed in HEK293; See COA

Rekonstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Storage

Store at -20°C,Avoid repeated freezing and thawing

Verschickt in

Ice chest + Ice pads

Stabilität und Lagerung

Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.

Bilder

SDS-PAGE: Recombinant Human MASP3 Protein (rp229167)

Recombinant Human MASP3 Protein (rp229167) - SDS-PAGE 

3 μg/lane of Recombinant Human MASP3 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 38.2-45.9 kDa under reducing conditions and 39.3-44.5 kDa under non-reducing conditions.

Häufig gestellte Fragen

What is the purity of this product, and how is it determined?

This product is supplied at ≥95% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.

How should this product be stored?

Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.

What does Animal Free mean?

Animal Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.

What does Carrier Free mean?

Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.

How is this product shipped?

This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.

What documentation is provided?

Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.