Recombinant Human MDC Protein, ＞97%(SDS-PAGE, HPLC)

Cat. No.: rp148631

QUALITÄT & REINHEIT Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, PBS Only, ≥97%(SDS-PAGE&HPLC)

Accession #

O00626

Protein Tag

No tag

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 10-100ng/ml.

Übersicht

Purity
>97% by SDS-PAGE and HPLC analyses.

Function
May play a role in the trafficking of activated/effector T-lymphocytes to inflammatory sites and other aspects of activated T-lymphocyte physiology. Chemotactic for monocytes, dendritic cells and natural killer cells. Mild chemoattractant for primary activated T-lymphocytes and a potent chemoattractant for chronically activated T-lymphocytes but has no chemoattractant activity for neutrophils, eosinophils, and resting T-lymphocytes. Binds to CCR4. Processed forms MDC(3-69), MDC(5-69) and MDC(7-69) seem not be active.

Spezifikationen

Product Name

Recombinant Human MDC Protein, ＞97%(SDS-PAGE, HPLC)

Synonyme

A-152E5.1 | ABCD-1 | CC chemokine STCP-1 | C-C motif chemokine 22 | CCL22 | chemokine (C-C motif) ligand 22 | DC/B-CK | Macrophage-derived chemokine | MDC | MDCStimulated T-cell chemotactic protein 1 | MGC34554 | SCYA22MDC(1-69) | small inducible cytokine

Note

ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance, PBS Only

Spezifikationen & Reinheit

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,PBS Only,≥97%(SDS-PAGE&HPLC)

Reinheit

＞97%(SDS-PAGE, HPLC)

Bioaktivität

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 10-100ng/ml.

Endotoxin-Konzentration

<1.0 EU/μg

Expression System

E. coli

Arten

Human

Aminosäuren

25-93aa

Sequenz

GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ

Protein Tag

No tag

Beitritt #

O00626

Voraussichtliches Molekulargewicht

8.1 kDa

SDS-PAGE

8.1 kDa

Molekültyp

Protein

Product Line

Biologische Produkte

Lagerung und Versand

Form

Lyophilized

Rekonstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL.

Storage

Store at -20°C

Verschickt in

Ice chest + Ice pads

Stabilität und Lagerung

Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, -20 to -70 °C under sterile conditions after reconst

Bilder

Protein Bioactivity: Recombinant Human MDC Protein (rp148631)

Recombinant Human MDC Protein (rp148631)-Protein Bioactivity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 10-100 ng/mL.

SDS-PAGE: Recombinant Human MDC Protein (rp148631)

Recombinant Human MDC Protein (rp148631)-SDS-PAGE
Recombinant Human MDC Protein was resolved with SDS-PAGE under reducing (R) and visualized by Coomassie® Blue staining, showing a single band at 8.1 kDa.

Häufig gestellte Fragen

What does Animal Free mean?

Animal Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.

What does Carrier Free mean?

Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.

How should this product be stored?

Store at ?20 °C. Freezer storage is required to maintain the specified shelf life.

How is this product shipped?

This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.

What documentation is provided?

Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.