Recombinant Human PCNA Protein, >95% (SDS-PAGE)

Cat. No.: rp149860

GRADE & PURITY Animal Free, Carrier Free, Azide Free, His Tag, PBS Only, ≥95%(SDS-PAGE)

Accession #

P12004

Protein Tag

N-His

Expression system

E. coli

Übersicht

Purity:
>95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Function:
This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Induces a robust stimulatory effect on the 3'-5' exonuclease and 3'-phosphodiesterase, but not apurinic-apyrimidinic (AP) endonuclease, APEX2 activities. Has to be loaded onto DNA in order to be able to stimulate APEX2.
Description:
Proliferating Cell Nuclear Antigen (PCNA) is a protein only expressed in normal proliferate cells and cancer cells. It is central to both DNA replication and repair. One of the well-established functions for PCNA is its role as the processivity factor for DNA polymerase delta and epsilon. PCNA tethers the polymerase catalytic unit to the DNA template for rapid and processive DNA synthesis. Two forms of PCNA exist in cells: (i) a detergent-insoluble trimeric form stably associated with the replicating forks during S phase and (ii) a soluble form in quiescent cells in G1 and G2 phases. PCNA forms a toroidal trimer in S phase with replication factor-C (RF-C) and DNA in an ATP-dependent manner and enables the loading of DNA polymerase delta and epsilon onto the complex. The close association of PCNA with kinase complexes involved in cell cycle machinery indicates that PCNA has a regulatory role in cell cycle progression. PCNA also participates in the processing of branched intermediates that arise during the lagging strand DNA synthesis.

Specifications

Product Name

Recombinant Human PCNA Protein, >95% (SDS-PAGE)

Synonyme

PCNA, Cyclin, Proliferating cell nuclear antigen | ATLD2 | cb16 | DNA polymerase delta auxiliary protein | etID36690.10 | fa28e03 | fb36g03 | HGCN8729 | MGC8367 | Mutagen-sensitive 209 protein | OTTHUMP00000030189 | OTTHUMP00000030190 | Pcna/cyclin | PCNA

Note

Animal Free, Azide Free, Carrier Free, His Tag, PBS Only

Spezifikationen & Reinheit

Animal Free,Carrier Free,Azide Free,His Tag,PBS Only,≥95%(SDS-PAGE)

Reinheit

>95% (SDS-PAGE)

Expression System

E. coli

Arten

Human

Aminosäuren

1-261aa

Sequenz

MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS

Protein Tag

N-His

Beitritt #

P12004

Voraussichtliches Molekulargewicht

32.3 kDa

SDS-PAGE

35.9 kDa, reducing conditions；35.9 kDa，non-reducing condition

Molekültyp

Protein

Lagerung und Versand

Form

Lyophilized

Rekonstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Storage

Store at -20°C,Avoid repeated freezing and thawing

Verschickt in

Ice chest + Ice pads

Stabilität und Lagerung

Store at -20°C stable for 1 year, store at 2-8℃ for 1 month. Avoid freeze / thaw cycle

Bilder

SDS-PAGE: Recombinant PCNA protein (rp149860)

Recombinant PCNA protein (rp149860) - SDS-PAGE
Recombinant PCNA protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 35.9 kDa.

Häufig gestellte Fragen

What is the purity of this product, and how is it determined?

This product is supplied at ≥95% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.

What does Animal Free mean?

Animal Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.

What does Carrier Free mean?

Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.

How should this product be stored?

Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.

How is this product shipped?

This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.

What documentation is provided?

Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.