Recombinant Human TSLPR Protein

Cat. No.: rp144716
Zu bestellen verfügbar
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. Fc tag ? Fc tag grade — recombinant protein bearing a Fc tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. The Fc tag aids dimerization and protein-A/G capture. ≥95%(SDS-PAGE)
Accession #
Q9HC73
Protein Tag
C-hFc & His
Expression system
HEK293
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Immobilized Human TSLP (R127A, R130A) at 1μg/ml (100μL/Well). Dose response curve for Human TSLPR, hFc Tag with the EC50 of 15.5 ng/mL.
★
Size
Deutschland (EU)
USA*
Price
Qty
10μg
rp144716-10μg
—
Auf Lager ≥10
93,63€
50μg
rp144716-50μg
—
3 Auf Lager
281,06€
100μg
rp144716-100μg
—
1 Auf Lager
451,14€
1mg
rp144716-1mg
Auf Bestellung · 8–12 Wochen
3.262,61€
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,His-Tag,Fc tag,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,Fc tag,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Übersicht

Receptor for thymic stromal lymphopoietin (TSLP). Forms a functional complex with TSLP and IL7R which is capable of stimulating cell proliferation through activation of STAT3 and STAT5. Also activates JAK2 (By similarity). Implicated in the development of the hematopoietic system.

Specifications

Product Name
Recombinant Human TSLPR Protein
Synonyme
Cytokine receptor-like 2 | IL-XR | Thymic stromal lymphopoietin protein receptor | TSLP receptor | CRL2cytokine receptor CRL2 precusor | CRL2 | CRLF2 | CRLF2Y | CRLM-2 | Cytokine receptor-like 2 | cytokine receptor-like factor 2 | ILXR | IL-XR | P2RY8/CRL
Note
ActiBioPure™, Animal Free, Bioactive, Carrier Free, Fc tag, His Tag
Spezifikationen & Reinheit
Animal Free,Carrier Free,Bioactive,ActiBioPure™,His-Tag,Fc tag,≥95%(SDS-PAGE)
Bioaktivität
Immobilized Human TSLP (R127A, R130A) at 1μg/ml (100μL/Well). Dose response curve for Human TSLPR, hFc Tag with the EC50 of 15.5 ng/mL.
Endotoxin-Konzentration
<0.1 EU/μg
Expression System
HEK293
Arten
Human
Aminosäuren
25-231 aa
Sequenz
GAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSKENLYFQGMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Protein Tag
C-hFc & His
Beitritt #
Voraussichtliches Molekulargewicht
51.9 kDa
SDS-PAGE
60 - 70 kDa, under reducing conditions; 120 - 150 kDa, under non-reducing conditions.
Molekültyp
Protein
Lagerung und Versand
Form
Liquid
Rekonstitution
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Verschickt in
Ice chest + Ice pads
Stabilität und Lagerung
Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Bilder

Recombinant Human TSLPR Protein ( rp144716) - SDS-PAGE
2 μg/lane of Recombinant Human TSLPR Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 60 - 70 kDa under reducing conditions and 120 - 150 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Zertifikate (CoA, COO, BSE/TSE und Analyse-Diagramm)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDatumArtikel
ZJ25F0217655Certificate of AnalysisSep 03, 2026 rp144716
ZJ25F0217656Certificate of AnalysisSep 03, 2026 rp144716
ZJ25F0217657Certificate of AnalysisSep 03, 2026 rp144716
Lösungsrechner
Bewertungen

Kundenbewertungen

Häufig gestellte Fragen

What is the purity of this product, and how is it determined?
This product is supplied at ≥95% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.
What does Animal Free mean?
Animal Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
What does Carrier Free mean?
Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
How should this product be stored?
Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.
How is this product shipped?
This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.
What documentation is provided?
Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.