Animal Free, Carrier Free, ≥75%(SDS-PAGE) Animal Free,Carrier Free for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Wet ice Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name

Recombinant Mouse BDNF Protein

Synonyme

Neurotrophic factor BDNF precursor form | proBDNF | Abrineurin | Brain-derived neurotrophic factor | Bdnf

Note

Animal Free, Carrier Free

Spezifikationen & Reinheit

Animal Free, Carrier Free, ≥75%(SDS-PAGE)

Biochemische und physiologische Mechanismen

Important signaling molecule that activates signaling cascades downstream of NTRK2. During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth

Aminosäuren

139-249 aa

Sequenz

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSTSGSGHHHHHHSAGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Beitritt #

P21237

Voraussichtliches Molekulargewicht

40 kDa

SDS-PAGE

43 kDa, under reducing conditions.

Molekültyp

Protein

Product Line

Biologische Produkte

Lagerung und Versand

Rekonstitution

Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.

Storage

Store at -20°C,Avoid repeated freezing and thawing

Verschickt in

Wet ice

Stabilität und Lagerung

Store at -20~-80℃ long term (1 year). Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Zertifikate (CoA, COO, BSE/TSE und Analyse-Diagramm)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot Number	Certificate Type	Datum	Artikel
ZJ26F1040029	Certificate of Analysis	Oct 23, 2026	rp330087
ZJ26F1040028	Certificate of Analysis	Oct 23, 2026	rp330087
ZJ26F1040027	Certificate of Analysis	Oct 23, 2026	rp330087

FAQs und Artikel

Molecular Markers in Neuroplasticity Research: BDNF/TrkB, CREB Phosphorylation, and Synaptic Protein Detection

Categories: Technical Articles: Reagent Chemistry, Synthesis & Bioscience Guides

Tags:

BDNF TrkB CREB PSD95 Synaptophysin Neuroplasticity Synaptic Proteins Neuronal Synapse

Neural Stem Cell Transplantation: Functional Restoration After Neural Injury

Categories: Technical Articles: Reagent Chemistry, Synthesis & Bioscience Guides

Tags:

remyelination neural stem cells neural progenitor cells neural injury spinal cord injury stroke neural regeneration neural circuitry

Lösungsrechner

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Reconstitution Calculator

Bewertungen

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Animal Free grade guide → View Carrier Free grade guide →

Bulk & Custom Packaging Need larger quantities or custom specifications? Contact our team for a tailored quote.

Dürfen wir Sie über Rabattaktionen informieren?

Später erinnern

Vielen Dank! Bitte überprüfen Sie Ihren E-Mail-Posteingang, um zu bestätigen.

Hoppla! Benachrichtigungen sind deaktiviert.

Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.