Recombinant MPXV E8L Protein, >95% (SDS-PAGE)

Cat. No.: rp155937

QUALITÄT & REINHEIT Animal Free, Carrier Free, Azide Free, His Tag, PBS Only, ≥95%(SDS-PAGE)

Accession #

Q8V4Y0

Protein Tag

C-His

Expression system

HEK293

Endotoxin Concentration

<1.0 EU/μg

Übersicht

Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Desscription:
Monkeypox Virus (MPXV), the virus that causes monkeypox infection in both humans and animals, is a double-stranded DNA virus that had a recent global outbreak in 2022. MPXV belongs to the Poxviridae family of viruses. It consists of several key subunits including a surface membrane fusion protein (A29L, ~14 kDa), two separate envelope proteins (A30L ~14 kDa and H3L ~32kDa), an envelope glycoprotein, (A35R ~15 kDa), a receptor glycoprotein that mimics IFN‑alpha/beta (B16, ~37kDa), a palmitoylated EEV membrane glycoprotein (C19L, ~35 kDa), a secreted IL-18 binding protein (D6L, ~14kDa), a cell surface-binding protein (E8L, ~32 kDa), a telomere binding protein (I1L, ~36kDa), and a subunit required for DNA packaging (L1R, 18 kDa). The E8L subunit in MPXV is a surface binding protein that plays a key role in viral entry. This happens with E8L binding to chondroitin sulfate on the surface of cells, giving MPXV virion attachment to the host cell. In infected samples, E8L is identified in abundance with intracellular proteins. When targeting the E8L subunit, transmission and replication was reduced by 78% when treated with 100 nM of small interference RNA (siRNA) and reduced by 95% when treated with 200 nM of siRNA. The E8L subunit is the most promising target for a newer, more effective vaccine against MPXV, as it has been found to contain human-foreign pentapeptides that could contain epitopes that would be viable for MPXV vaccinations.

Spezifikationen

Product Name

Recombinant MPXV E8L Protein, >95% (SDS-PAGE)

Synonyme

Cell surface-binding protein OPG105 | Carbonic anhydrase homolog | E8L | IMV membrane protein E8L | Cell surface-binding protein OPG105 | Carbonic anhydrase homolog | E8L | IMV membrane protein E8L

Note

Animal Free, Azide Free, Carrier Free, His Tag, PBS Only

Spezifikationen & Reinheit

Animal Free,Carrier Free,Azide Free,His Tag,PBS Only,≥95%(SDS-PAGE)

Reinheit

>95% (SDS-PAGE)

Endotoxin-Konzentration

<1.0 EU/μg

Expression System

HEK293

Aminosäuren

1-275 aa

Sequenz

MPQQLSPINIETKKAISDTRLKTLDIHYNESKPTTIQNTGKLVRINFKGGYISGGFLPNEYVLSTIHIYWGKEDDYGSNHLIDVYKYSGEINLVHWNKKKYSSYEEAKKHDDGIIIIAIFLQVSDHKNVYFQKIVNQLDSIRSANMSAPFDSVFYLDNLLPSTLDYFTYLGTTINHSADAAWIIFPTPINIHSDQLSKFRTLLSSSNHEGKPHYITENYRNPYKLNDDTQVYYSGEIIRAATTSPVRENYFMKWLSDLREACFSYYQKYIEGNKTENLYFQGHHHHHH

Protein Tag

C-His

Beitritt #

Q8V4Y0

Voraussichtliches Molekulargewicht

35.8 kDa

SDS-PAGE

35-55 and 65-100 kDa, under reducing conditions; 35-55 and 65-100 kDa, under non-reducing conditions

Molekültyp

Protein

Product Line

Biologische Produkte

Lagerung und Versand

Form

Lyophilized

Rekonstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Storage

Store at -20°C,Avoid repeated freezing and thawing

Verschickt in

Ice chest + Ice pads

Stabilität und Lagerung

Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle.

Bilder

SDS-PAGE: Recombinant MPXV E8L Protein (rp155937)

Recombinant MPXV E8L Protein (rp155937) - SDS-PAGE
2 μg/lane of Recombinant MPXV E8L Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 35-55 & 65-100 kDa under reducing conditions and 35-55 & 65-100 kDa under non-reducing conditions.

Häufig gestellte Fragen

What is the purity of this product, and how is it determined?

This product is supplied at ≥95% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.

What does Animal Free mean?

Animal Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.

What does Carrier Free mean?

Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.

How should this product be stored?

Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.

How is this product shipped?

This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.

What documentation is provided?

Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.