Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Retinol-binding protein 4 |
|---|
Gene and Protein Information
| Gene ID | 5950 |
|---|---|
| Uniprot Accession IDs | P02753 D3DR38 O43478 O43479 Q5VY24 Q8WWA3 Q9P178 |
| Ensembl ID | ENSP00000360522 |
| Symbol | RDCCAS MCOPCB10 |
| Family | Belongs to the calycin superfamily. Lipocalin family. |
| Sequence | MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 450617 | RBP4 | retinol binding protein 4 | 9598 | VGNC:5717 | Inparanoid, OMA, EggNOG |
| Mouse | 19662 | Rbp4 | retinol binding protein 4, plasma | 10090 | MGI:97879 | Inparanoid, OMA, EggNOG |
| Rat | 25703 | Rbp4 | retinol binding protein 4 | 10116 | RGD:3546 | Inparanoid, OMA, EggNOG |
| Dog | 477775 | RBP4 | retinol binding protein 4 | 9615 | VGNC:45432 | Inparanoid, OMA, EggNOG |
| Horse | 100049790 | RBP4 | retinol binding protein 4 | 9796 | VGNC:49533 | Inparanoid, OMA, EggNOG |
| Cow | 281444 | RBP4 | retinol binding protein 4 | 9913 | VGNC:33815 | Inparanoid, OMA, EggNOG |
| Pig | 397124 | RBP4 | retinol binding protein 4 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100023751 | RBP4 | retinol binding protein 4 | 13616 | Inparanoid, EggNOG | |
| Chicken | 396166 | RBP4A | retinol binding protein 4 A, plasma | 9031 | CGNC:49682 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100566565 | rbp4 | retinol binding protein 4 | 28377 | Inparanoid, OMA | |
| Xenopus | 548465 | rbp4 | retinol binding protein 4 | 8364 | XB-GENE-5841608 | Inparanoid, OMA |
| Zebrafish | 30077 | rbp4 | retinol binding protein 4, plasma | 7955 | ZDB-GENE-000210-19 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Spezifikationen | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.