🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS / CoA Structure Masse & benutzerdefinierte
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

RAMP2

BeschreibungReceptor activity-modifying protein 2

Gene and Protein Information

Gene ID10266
Uniprot Accession IDs O60895 A7L9S6 K7EMD3 Q8N1F2
Ensembl ID ENSP00000253796
FamilyBelongs to the RAMP family.
Sequence
MASLRVERAGGPRLPRTRVGRPAALRLLLLLGAVLNPHEALAQPLPTTGTPGSEGGTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQPTFSDPPEDVLLAMIIAPICLIPFLITLVVWRSKDSEAQA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp454698RAMP2receptor activity modifying protein 29598VGNC:9553OMA, EggNOG
Macaque707718RAMP2receptor activity modifying protein 29544Inparanoid, OMA, EggNOG
Mouse54409Ramp2receptor (calcitonin) activity modifying protein 210090MGI:1859650Inparanoid, OMA, EggNOG
Rat58966Ramp2receptor activity modifying protein 210116RGD:61872Inparanoid, OMA, EggNOG
Dog480515RAMP2receptor activity modifying protein 29615Inparanoid, OMA, EggNOG
HorseRAMP2receptor activity modifying protein 2 [Source:HGNC Symbol;Acc:HGNC:9844]9796OMA, EggNOG
Cow504230RAMP2receptor activity modifying protein 29913VGNC:33707Inparanoid, OMA, EggNOG
Pig397155RAMP2receptor activity modifying protein 29823Inparanoid, OMA, EggNOG
Opossum100011362RAMP2receptor activity modifying protein 213616Inparanoid, OMA, EggNOG
Chicken420022RAMP2receptor activity modifying protein 29031CGNC:17380Inparanoid, EggNOG
Anole lizardRAMP2receptor activity modifying protein 2 [Source:HGNC Symbol;Acc:HGNC:9844]28377Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.