RAMP1

BeschreibungReceptor activity-modifying protein 1

Gene and Protein Information

Gene ID10267
Uniprot Accession IDs O60894 Q6FGS5
Ensembl ID ENSP00000254661
FamilyBelongs to the RAMP family.
Sequence
MARALCRLPRRGLWLLLAHHLFMTTACQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILYPFIVVPITVTLLVTALVVWQSKRTEGIV
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Mouse51801Ramp1receptor (calcitonin) activity modifying protein 110090MGI:1858418Inparanoid, OMA, EggNOG
Rat58965Ramp1receptor activity modifying protein 110116RGD:61870Inparanoid, OMA, EggNOG
DogRAMP1receptor activity modifying protein 1 [Source:HGNC Symbol;Acc:HGNC:9843]9615OMA, EggNOG
Horse100066550RAMP1receptor activity modifying protein 19796VGNC:22168Inparanoid, OMA, EggNOG
Cow617017RAMP1receptor activity modifying protein 19913Inparanoid, EggNOG
Pig397401RAMP1receptor activity modifying protein 19823Inparanoid, OMA, EggNOG
Chicken424016RAMP1receptor activity modifying protein 19031CGNC:2798Inparanoid, OMA, EggNOG
Anole lizard100563905ramp1receptor activity modifying protein 128377Inparanoid, OMA, EggNOG
Xenopus780274ramp1receptor (G protein-coupled) activity modifying protein 18364XB-GENE-1010532Inparanoid, OMA, EggNOG
Zebrafish436966zgc:91818zgc:918187955ZDB-GENE-040718-446Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.