Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Ras-related protein Rab-24 |
|---|
Gene and Protein Information
| Gene ID | 53917 |
|---|---|
| Uniprot Accession IDs | Q969Q5 A0A024R7N9 Q7Z4Z7 |
| Ensembl ID | ENSP00000304376 |
| Family | Belongs to the small GTPase superfamily. Rab family. |
| Sequence | MSGQRVDVKVVMLGKEYVGKTSLVERYVHDRFLVGPYQNTIGAAFVAKVMSVGDRTVTLGIWDTAGSERYEAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKSDLLEEDRRRRRVDFHDVQDYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQVMTEDKGVDLGQKPNPYFYSCCHH |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 471755 | RAB24 | RAB24, member RAS oncogene family | 9598 | VGNC:8633 | OMA, EggNOG |
| Macaque | 698876 | RAB24 | RAB24, member RAS oncogene family | 9544 | OMA, EggNOG | |
| Mouse | 19336 | Rab24 | RAB24, member RAS oncogene family | 10090 | MGI:105065 | Inparanoid, OMA, EggNOG |
| Dog | 479277 | RAB24 | RAB24, member RAS oncogene family | 9615 | VGNC:45264 | Inparanoid, OMA, EggNOG |
| Horse | 100058530 | RAB24 | RAB24, member RAS oncogene family | 9796 | VGNC:22097 | Inparanoid, OMA, EggNOG |
| Cow | 617635 | RAB24 | RAB24, member RAS oncogene family | 9913 | VGNC:33631 | Inparanoid, OMA, EggNOG |
| Pig | 100511865 | RAB24 | RAB24, member RAS oncogene family | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100027665 | RAB24 | RAB24, member RAS oncogene family | 13616 | Inparanoid, EggNOG | |
| Chicken | 427627 | RAB24 | RAB24, member RAS oncogene family | 9031 | CGNC:2157 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100563654 | rab24 | RAB24, member RAS oncogene family | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 548925 | rab24 | RAB24, member RAS oncogene family | 8364 | XB-GENE-491489 | Inparanoid, OMA, EggNOG |
| Zebrafish | 574423 | rab24 | RAB24, member RAS oncogene family | 7955 | ZDB-GENE-050706-110 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Spezifikationen | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.