🌎 Ship to: United States
Toggle Nav
Cart
Search
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

RFC3

BeschreibungReplication factor C subunit 3

Gene and Protein Information

Gene ID5983
Uniprot Accession IDs P40938 C9JU95 O15252 Q5W0E8
Ensembl ID ENSP00000369411
Symbol RFC38
FamilyBelongs to the activator 1 small subunits family.
Sequence
MSLWVDKYRPCSLGRLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGVGVEKLRIEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICHVLSTVCKKEGLNLPSQLAHRLAEKSCRNLRKALLMCEACRVQQYPFTADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMMF
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp452533RFC3replication factor C subunit 39598VGNC:5099OMA, EggNOG
Macaque714220RFC3replication factor C subunit 39544Inparanoid, OMA, EggNOG
Mouse69263Rfc3replication factor C (activator 1) 310090MGI:1916513Inparanoid, OMA, EggNOG
Rat288414Rfc3replication factor C subunit 310116RGD:1306832Inparanoid, OMA, EggNOG
Dog477308RFC3replication factor C subunit 39615VGNC:45494Inparanoid, OMA, EggNOG
Horse100062326RFC3replication factor C subunit 39796VGNC:22320Inparanoid, OMA, EggNOG
Cow515602RFC3replication factor C subunit 39913VGNC:33887Inparanoid, OMA, EggNOG
Pig100156440RFC3replication factor C subunit 39823Inparanoid, OMA, EggNOG
Opossum100020774RFC3replication factor C subunit 313616Inparanoid, OMA, EggNOG
Platypus100078299RFC3replication factor C subunit 39258Inparanoid, OMA, EggNOG
Chicken418907RFC3replication factor C subunit 39031CGNC:12816Inparanoid, OMA, EggNOG
Anole lizard100558796rfc3replication factor C subunit 328377Inparanoid, OMA, EggNOG
Xenopus100493161rfc3replication factor C subunit 38364XB-GENE-984444Inparanoid, OMA, EggNOG
Zebrafish259256rfc3replication factor C (activator 1) 37955ZDB-GENE-020809-3Inparanoid, OMA
C. elegans178259rfc-3RFC (DNA replication factor) family6239Inparanoid, OMA
Fruitfly34550RfC38Replication factor C 38kD subunit7227FBgn0028700Inparanoid, EggNOG
S.cerevisiae852383RFC5replication factor C subunit 54932S000000291Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    DNA-directed DNA polymerase    /    Replication factor C subunit 3
protein    /    nucleic acid binding    /    nucleotidyltransferase    /    Replication factor C subunit 3
DTO Classes
protein    /    Enzyme    /    Transferase    /    Nucleotidyltransferase    /    Polymerase    /    DNA-directed DNA polymerase    /    Replication factor C subunit 3

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.