🌎 Versand an: United States
Navigation umschalten
Warenkorb
Suche
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Struktur Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

RAC2

BeschreibungRas-related C3 botulinum toxin substrate 2

Gene and Protein Information

Gene ID5880
Uniprot Accession IDs P15153 Q9UDJ4
Ensembl ID ENSP00000249071
Symbol Gx EN-7 HSPC022 p21-Rac2
FamilyBelongs to the small GTPase superfamily. Rho family.
Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Mouse19354Rac2Rac family small GTPase 210090MGI:97846Inparanoid, OMA
Rat366957Rac2Rac family small GTPase 210116RGD:1307568Inparanoid, OMA
Dog481271RAC2Rac family small GTPase 29615VGNC:49610Inparanoid, OMA
Horse100054701RAC2Rac family small GTPase 29796VGNC:49130Inparanoid, OMA
Cow327671RAC2Rac family small GTPase 29913VGNC:49061Inparanoid, OMA
OpossumRAC2Rac family small GTPase 2 [Source:HGNC Symbol;Acc:HGNC:9802]13616Inparanoid, OMA
Platypus100092844RAC2Rac family small GTPase 29258Inparanoid, OMA
Chicken418044RAC2ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)9031CGNC:9462Inparanoid, OMA
Anole lizard100557692rac2Rac family small GTPase 228377Inparanoid, OMA
Zebrafish415151rac2Rac family small GTPase 27955ZDB-GENE-040625-27Inparanoid, OMA
C. elegans186939rac-2Ras-related protein rac-26239Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    small GTPase    /    Ras-related C3 botulinum toxin substrate 2
DTO Classes
protein    /    Enzyme modulator    /    G-protein    /    Small GTPase    /    Ras-related C3 botulinum toxin substrate 2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpezifikationenSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Dürfen wir Sie über Rabattaktionen informieren?

      Später erinnern

      Vielen Dank! Bitte überprüfen Sie Ihren E-Mail-Posteingang, um zu bestätigen.

      Hoppla! Benachrichtigungen sind deaktiviert.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.