🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS / CoA Structure Masse & benutzerdefinierte
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

RAB8A

BeschreibungRas-related protein Rab-8A

Gene and Protein Information

Gene ID4218
Uniprot Accession IDs P61006 B4DEK7 P24407 Q6FHV5
Ensembl ID ENSP00000300935
Symbol MEL RAB8 MEL RAB8
FamilyBelongs to the small GTPase superfamily. Rab family.
Sequence
MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp468760RAB8ARAB8A, member RAS oncogene family9598VGNC:7571OMA, EggNOG
Macaque100423251RAB8ARAB8A, member RAS oncogene family9544Inparanoid, OMA, EggNOG
Mouse17274Rab8aRAB8A, member RAS oncogene family10090MGI:96960Inparanoid, OMA, EggNOG
Rat117103Rab8aRAB8A, member RAS oncogene family10116RGD:621144Inparanoid, OMA, EggNOG
Dog403773RAB8ARAB8A, member RAS oncogene family9615VGNC:45295Inparanoid, OMA
Horse100147248RAB8ARAB8A, member RAS oncogene family9796VGNC:22128Inparanoid, OMA
Cow100125881RAB8ARAB8A, member RAS oncogene family9913VGNC:33662Inparanoid, OMA
Pig100511006RAB8ARAB8A, member RAS oncogene family9823Inparanoid, OMA
Chicken428352RAB8ARAB8A, member RAS oncogene family9031CGNC:66558Inparanoid, OMA
Xenopus100125217rab8aRAB8A, member RAS oncogene family8364XB-GENE-1018135Inparanoid, OMA
Zebrafish571897rab8aRAB8A, member RAS oncogene family7955ZDB-GENE-070424-36Inparanoid, OMA
C. elegans171935rab-8RAB family6239Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.