RXFP4

BeschreibungRelaxin-3 receptor 2

Gene and Protein Information

Gene ID339403
Uniprot Accession IDs Q8TDU9 B0M0L4 Q3MJB1 Q8NGZ8 RLN3 receptor 2
Ensembl ID ENSP00000357301
Symbol GPR100 RLN3R2 GPR100 RLN3R2 RXFPR4 GPCR142
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MPTLNTSASPPTFFWANASGGSVLSADDAPMPVKFLALRLMVALAYGLVGAIGLLGNLAVLWVLSNCARRAPGPPSDTFVFNLALADLGLALTLPFWAAESALDFHWPFGGALCKMVLTATVLNVYASIFLITALSVARYWVVAMAAGPGTHLSLFWARIATLAVWAAAALVTVPTAVFGVEGEVCGVRLCLLRFPSRYWLGAYQLQRVVLAFMVPLGVITTSYLLLLAFLQRRQRRRQDSRVVARSVRILVASFFLCWFPNHVVTLWGVLVKFDLVPWNSTFYTIQTYVFPVTTCLAHSNSCLNPVLYCLLRREPRQALAGTFRDLRLRLWPQGGGWVQQVALKQVGRRWVASNPRESRPSTLLTNLDRGTPG
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp742539RXFP4relaxin family peptide/INSL5 receptor 49598VGNC:9456OMA, EggNOG
Macaque718025RXFP4relaxin/insulin like family peptide receptor 49544Inparanoid, OMA, EggNOG
Mouse242093Rxfp4relaxin family peptide receptor 410090MGI:2182926Inparanoid, OMA, EggNOG
Horse100063783RXFP4relaxin family peptide/INSL5 receptor 49796VGNC:22638Inparanoid, OMA
OpossumRXFP4relaxin/insulin like family peptide receptor 4 [Source:HGNC Symbol;Acc:HGNC:14666]13616Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Relaxin-3 receptor 2
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Relaxin-3 receptor 2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.