🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS / CoA Structure Masse & benutzerdefinierte
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

GJA4

BeschreibungGap junction alpha-4 protein

Gene and Protein Information

Gene ID2701
Uniprot Accession IDs P35212 A8K698 D3DPR4 Q9P106 Q9UBL1 Q9UNA9 Q9UNB0 Q9UNB1 Q9Y5N7
Ensembl ID ENSP00000343676
Symbol CX37
FamilyBelongs to the connexin family. Alpha-type (group II) subfamily.
Sequence
MGDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLAGESVWGDEQSDFECNTAQPGCTNVCYDQAFPISHIRYWVLQFLFVSTPTLVYLGHVIYLSRREERLRQKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVASVLCKSVLEAGFLYGQWRLYGWTMEPVFVCQRAPCPYLVDCFVSRPTEKTIFIIFMLVVGLISLVLNLLELVHLLCRCLSRGMRARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPTYNGLSSSEQNWANLTTEERLASSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Mouse14612Gja4gap junction protein, alpha 410090MGI:95715Inparanoid, OMA, EggNOG
Rat25655Gja4gap junction protein, alpha 410116RGD:2691Inparanoid, OMA, EggNOG
Dog482485GJA4gap junction protein alpha 49615VGNC:41234Inparanoid, OMA, EggNOG
Horse100055536GJA4gap junction protein alpha 49796VGNC:18351Inparanoid, OMA, EggNOG
Cow538913GJA4gap junction protein alpha 49913VGNC:29373Inparanoid, OMA, EggNOG
Opossum100031172GJA4gap junction protein alpha 413616Inparanoid, OMA, EggNOG
PlatypusGJA4gap junction protein alpha 4 [Source:HGNC Symbol;Acc:HGNC:4278]9258OMA, EggNOG
Chicken404529GJA4gap junction protein alpha 49031CGNC:1818Inparanoid, OMA
Anole lizard100559691gja4gap junction protein alpha 428377Inparanoid, OMA, EggNOG
Xenopus780366gja4gap junction protein alpha 48364XB-GENE-977956Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    cell junction protein    /    gap junction    /    Gap junction alpha-4 protein
DTO Classes
protein    /    Cell-cell junction    /    Gap junction    /    Gap junction alpha-4 protein

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.