🌎 Ship to: United States
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | Neutrophil elastase |
|---|
Gene and Protein Information
| Gene ID | 1991 |
|---|---|
| Uniprot Accession IDs | P08246 P09649 Q6B0D9 Q6LDP5 |
| Ensembl ID | ENSP00000466090 |
| Symbol | ELA2 GE NE HLE HNE ELA2 SCN1 PMN-E |
| Family | Belongs to the peptidase S1 family. Elastase subfamily. |
| Sequence | MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 749897 | ELANE | elastase, neutrophil expressed | 9598 | OMA, EggNOG | |
| Macaque | 106992354 | ELANE | elastase, neutrophil expressed | 9544 | OMA, EggNOG | |
| Mouse | 50701 | Elane | elastase, neutrophil expressed | 10090 | MGI:2679229 | Inparanoid, OMA, EggNOG |
| Rat | 299606 | Elane | elastase, neutrophil expressed | 10116 | RGD:1307968 | Inparanoid, OMA, EggNOG |
| Dog | 442980 | ELANE | elastase, neutrophil expressed | 9615 | Inparanoid, OMA, EggNOG | |
| Cow | 100126050 | ELANE | elastase, neutrophil expressed | 9913 | VGNC:28423 | Inparanoid, OMA, EggNOG |
| Pig | 100522182 | ELANE | elastase, neutrophil expressed | 9823 | OMA, EggNOG | |
| Opossum | 100030465 | LOC100030465 | neutrophil elastase | 13616 | Inparanoid, OMA, EggNOG | |
| Xenopus | 448597 | prtn3 | proteinase 3 | 8364 | XB-GENE-5805214 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.