🌎 Versand an: United States
Navigation umschalten
Warenkorb
Suche
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Struktur Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

NDUFB11

BeschreibungNADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial

Gene and Protein Information

Gene ID54539
Uniprot Accession IDs Q9NX14 Q5JRR3 Q5JRR4 Q6IAB6 Q8WZ96 Q9BXX9
Ensembl ID ENSP00000276062
Symbol ESSS Np15 P17.3 NP17.3 CI-ESSS MC1DN30
FamilyBelongs to the complex I NDUFB11 subunit family.
Sequence
MAAGLFGLSARRLLAAAATRGLPAARVRWESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFGVSIILVLGSTFVAYLPDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp473588NDUFB11NADH:ubiquinone oxidoreductase subunit B119598VGNC:14736Inparanoid, OMA, EggNOG
Mouse104130Ndufb11NADH:ubiquinone oxidoreductase subunit B1110090MGI:1349919Inparanoid, OMA
Rat299310Ndufb11NADH:ubiquinone oxidoreductase subunit B1110116RGD:1563698Inparanoid, OMA, EggNOG
Dog480894NDUFB11NADH:ubiquinone oxidoreductase subunit B119615VGNC:43700Inparanoid, OMA, EggNOG
Horse100060719NDUFB11NADH:ubiquinone oxidoreductase subunit B119796VGNC:20637Inparanoid, OMA, EggNOG
Cow404161NDUFB11NADH:ubiquinone oxidoreductase subunit B119913VGNC:31961Inparanoid, OMA, EggNOG
Opossum100618050NDUFB11NADH:ubiquinone oxidoreductase subunit B1113616Inparanoid, OMA, EggNOG
Zebrafish562219ndufb11NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 117955ZDB-GENE-050309-25Inparanoid, EggNOG
Fruitfly42282NP15.6CG6008 gene product from transcript CG6008-RA7227FBgn0027785Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Dürfen wir Sie über Rabattaktionen informieren?

      Später erinnern

      Vielen Dank! Bitte überprüfen Sie Ihren E-Mail-Posteingang, um zu bestätigen.

      Hoppla! Benachrichtigungen sind deaktiviert.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.