🌎 Ship to: United States
Toggle Nav
Cart
Search
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

RGN

BeschreibungRegucalcin

Gene and Protein Information

Gene ID9104
Uniprot Accession IDs Q15493 A4FTW1 A8K271 Q53FC9 Q5JRR5 RC
Ensembl ID ENSP00000380365
Symbol SMP30 RC GNL SMP30 HEL-S-41
FamilyBelongs to the SMP-30/CGR1 family.
Sequence
MSSIKIECVLPENCRCGESPVWEEVSNSLLFVDIPAKKVCRWDSFTKQVQRVTMDAPVSSVALRQSGGYVATIGTKFCALNWKEQSAVVLATVDNDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGALYSLFPDHHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMCIDAEGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGGIFKITGLGVKGIAPYSYAG
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp107970955RGNregucalcin9598Inparanoid, EggNOG
Macaque705733RGNregucalcin9544Inparanoid, OMA, EggNOG
Mouse19733Rgnregucalcin10090MGI:108024Inparanoid, OMA, EggNOG
Rat25106Rgnregucalcin10116RGD:3560Inparanoid, OMA, EggNOG
Dog480893RGNregucalcin9615VGNC:45516Inparanoid, OMA, EggNOG
Horse100060684RGNregucalcin9796VGNC:22336OMA, EggNOG
Cow280910RGNregucalcin9913VGNC:33907Inparanoid, OMA, EggNOG
Pig768107RGNregucalcin9823Inparanoid, OMA, EggNOG
Opossum100010821LOC100010821regucalcin-like13616OMA, EggNOG
Chicken395480RGNregucalcin9031CGNC:49339Inparanoid, OMA
Anole lizard100568168rgnregucalcin28377Inparanoid, OMA, EggNOG
Xenopus448549rgnregucalcin8364XB-GENE-483637Inparanoid, OMA, EggNOG
Zebrafish403070rgnregucalcin7955ZDB-GENE-040718-68Inparanoid, OMA
S.cerevisiae852342YBR053Chypothetical protein4932S000000257Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    hydrolase    /    esterase    /    Regucalcin
protein    /    hydrolase    /    calcium-binding protein    /    Regucalcin
DTO Classes
protein    /    Enzyme    /    Hydrolase    /    Esterase    /    Regucalcin

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.