🌎 Ship to: United States
Navigation umschalten 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | Regulator of G-protein signaling 17 |
|---|
Gene and Protein Information
| Gene ID | 26575 |
|---|---|
| Uniprot Accession IDs | Q9UGC6 Q5TF49 Q8TD61 Q9UJS8 RGS17 |
| Ensembl ID | ENSP00000356194 |
| Symbol | RGSZ2 RGSZ2 RGS-17 hRGS17 |
| Sequence | MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 737204 | RGS17 | regulator of G protein signaling 17 | 9598 | VGNC:11204 | OMA, EggNOG |
| Macaque | 100429275 | RGS17 | regulator of G protein signaling 17 | 9544 | OMA, EggNOG | |
| Mouse | 56533 | Rgs17 | regulator of G-protein signaling 17 | 10090 | MGI:1927469 | Inparanoid, OMA, EggNOG |
| Rat | 308118 | Rgs17 | regulator of G-protein signaling 17 | 10116 | RGD:1305515 | Inparanoid, OMA, EggNOG |
| Dog | 608867 | RGS17 | regulator of G protein signaling 17 | 9615 | VGNC:45526 | Inparanoid, OMA, EggNOG |
| Horse | 100060098 | RGS17 | regulator of G protein signaling 17 | 9796 | VGNC:22345 | Inparanoid, OMA, EggNOG |
| Cow | 504255 | RGS17 | regulator of G protein signaling 17 | 9913 | VGNC:33916 | Inparanoid, OMA, EggNOG |
| Pig | 100514020 | RGS17 | regulator of G protein signaling 17 | 9823 | OMA, EggNOG | |
| Opossum | 100027291 | RGS17 | regulator of G protein signaling 17 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | RGS17 | regulator of G protein signaling 17 [Source:HGNC Symbol;Acc:HGNC:14088] | 9258 | OMA, EggNOG | ||
| Chicken | 395645 | RGS17 | regulator of G-protein signaling 17 | 9031 | CGNC:66208 | Inparanoid, OMA |
| Anole lizard | 100558841 | rgs17 | regulator of G protein signaling 17 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | rgs17 | regulator of G-protein signaling 17 [Source:Xenbase;Acc:XB-GENE-984104] | 8364 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / enzyme modulator / G-protein modulator / Regulator of G-protein signaling 17
protein / enzyme modulator / G-protein modulator / Regulator of G-protein signaling 17
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.