🌎 Ship to: United States
Navigation umschalten 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | Regulator of G-protein signaling 4 |
|---|
Gene and Protein Information
| Gene ID | 5999 |
|---|---|
| Uniprot Accession IDs | P49798 A7XA56 A7XA58 A7XA59 A7YVV7 B1APZ3 RGP4 |
| Ensembl ID | ENSP00000397181 |
| Symbol | RGP4 SCZD9 |
| Sequence | MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCA |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 457470 | RGS4 | regulator of G protein signaling 4 | 9598 | VGNC:8097 | OMA, EggNOG |
| Macaque | 693383 | RGS4 | regulator of G protein signaling 4 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 19736 | Rgs4 | regulator of G-protein signaling 4 | 10090 | MGI:108409 | Inparanoid, OMA, EggNOG |
| Rat | 29480 | Rgs4 | regulator of G-protein signaling 4 | 10116 | RGD:3567 | Inparanoid, OMA, EggNOG |
| Dog | 488666 | RGS4 | regulator of G protein signaling 4 | 9615 | VGNC:45534 | Inparanoid, OMA, EggNOG |
| Horse | 100058342 | RGS4 | regulator of G protein signaling 4 | 9796 | VGNC:22353 | Inparanoid, OMA, EggNOG |
| Cow | 617437 | RGS4 | regulator of G protein signaling 4 | 9913 | VGNC:54394 | Inparanoid, OMA, EggNOG |
| Pig | 100157437 | RGS4 | regulator of G protein signaling 4 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100012570 | RGS4 | regulator of G protein signaling 4 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 378901 | RGS4 | regulator of G-protein signaling 4 | 9031 | CGNC:49134 | Inparanoid, OMA, EggNOG |
| Xenopus | 394913 | rgs4 | regulator of G-protein signaling 4 | 8364 | XB-GENE-942771 | Inparanoid, OMA, EggNOG |
| Zebrafish | 569876 | rgs4 | regulator of G protein signaling 4 | 7955 | ZDB-GENE-030131-9839 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / enzyme modulator / G-protein modulator / Regulator of G-protein signaling 4
protein / enzyme modulator / G-protein modulator / Regulator of G-protein signaling 4
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.