🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS / CoA Structure Masse & benutzerdefinierte
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

RHAG

BeschreibungAmmonium transporter Rh type A

Gene and Protein Information

Gene ID6005
Uniprot Accession IDs Q02094 B2R8T8 O43514 O43515 Q7L8L3 Q9H454
Ensembl ID ENSP00000360217
Symbol RH50 OHS RH2 OHST RHNR Rh50 CD241 RH50A Rh50GP SLC42A1
FamilyBelongs to the ammonium transporter (TC 2.A.49) family. Rh subfamily.
Sequence
MRFTFPLMAIVLEIAMIVLFGLFVEYETDQTVLEQLNITKPTDMGIFFELYPLFQDVHVMIFVGFGFLMTFLKKYGFSSVGINLLVAALGLQWGTIVQGILQSQGQKFNIGIKNMINADFSAATVLISFGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFGAYFGLAVAGILYRSGLRKGHENEESAYYSDLFAMIGTLFLWMFWPSFNSAIAEPGDKQCRAIVNTYFSLAACVLTAFAFSSLVEHRGKLNMVHIQNATLAGGVAVGTCADMAIHPFGSMIIGSIAGMVSVLGYKFLTPLFTTKLRIHDTCGVHNLHGLPGVVGGLAGIVAVAMGASNTSMAMQAAALGSSIGTAVVGGLMTGLILKLPLWGQPSDQNCYDDSVYWKVPKTR
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp450105RHAGRh associated glycoprotein9598VGNC:48932Inparanoid, OMA, EggNOG
Macaque574120RHAGRh associated glycoprotein9544Inparanoid, OMA, EggNOG
Mouse19743RhagRhesus blood group-associated A glycoprotein10090MGI:1202713Inparanoid, OMA, EggNOG
Rat65207RhagRh-associated glycoprotein10116RGD:61871Inparanoid, OMA, EggNOG
Dog481833RHAGRh associated glycoprotein9615VGNC:45542Inparanoid, OMA, EggNOG
Horse100068779RHAGRh associated glycoprotein9796VGNC:22359Inparanoid, OMA, EggNOG
Cow281454RHAGRh associated glycoprotein9913VGNC:33929Inparanoid, OMA, EggNOG
Pig100516620RHAGRh associated glycoprotein9823OMA, EggNOG
Opossum100015607RHAGRh associated glycoprotein13616Inparanoid, OMA, EggNOG
PlatypusRHAGRh associated glycoprotein [Source:HGNC Symbol;Acc:HGNC:10006]9258OMA, EggNOG
Chicken395118RHAGRh-associated glycoprotein9031CGNC:12504Inparanoid, OMA, EggNOG
Anole lizardRHAGRh associated glycoprotein [Source:HGNC Symbol;Acc:HGNC:10006]28377Inparanoid, OMA, EggNOG
XenopusXB-GENE-983543Putative ortholog of 50 kD glycoprotein (Rh50), 1 of 1 [Source:Xenbase;Acc:XB-GENE-983543]8364OMA, EggNOG
Zebrafish405771rhagRh associated glycoprotein7955ZDB-GENE-030131-8229Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    transporter    /    cation transporter    /    Ammonium transporter Rh type A
DTO Classes
protein    /    Transporter    /    SLC superfamily of solute carriers    /    SLC42 family of Rhesus glycoprotein ammonium transporters    /    Ammonium transporter Rh type A

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.