🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS CoA Structure
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

PRKCZ

BeschreibungProtein kinase C zeta type

Gene and Protein Information

Gene ID5590
Uniprot Accession IDs Q05513 A8K4N0 A8MU64 B7Z2J7 E9PCW2 Q15207 Q5SYT5 Q969S4
Ensembl ID ENSP00000367830
Symbol PKC2 PKC2 PKC-ZETA
FamilyBelongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily.
Sequence
MPSRTGPKMEGSGGRVRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLARQCRDEGLIIHVFPSTPEQPGLPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Macaque100430236LOC100430236protein kinase C zeta type-like9544Inparanoid, OMA, EggNOG
Mouse18762Prkczprotein kinase C, zeta10090MGI:97602Inparanoid, OMA
Rat25522Prkczprotein kinase C, zeta10116RGD:3399Inparanoid, OMA
Dog479577PRKCZprotein kinase C zeta9615VGNC:44985Inparanoid, OMA
Horse100064240PRKCZprotein kinase C zeta9796VGNC:21850Inparanoid, OMA
Cow286877PRKCZprotein kinase C zeta9913VGNC:33336Inparanoid, OMA
Chicken419399PRKCZprotein kinase C zeta9031CGNC:866Inparanoid, OMA
Xenopus100101769prkczprotein kinase C zeta8364XB-GENE-494709Inparanoid, OMA
Zebrafish555737prkczprotein kinase C, zeta7955ZDB-GENE-070511-1Inparanoid, OMA
C. elegans173914pkc-3Protein kinase C-like 36239Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    calcium-binding protein    /    non-receptor serine/threonine protein kinase    /    Protein kinase c zeta type
protein    /    calcium-binding protein    /    transfer/carrier protein    /    Protein kinase c zeta type
protein    /    calcium-binding protein    /    protein kinase    /    Protein kinase c zeta type
protein    /    calcium-binding protein    /    calmodulin    /    Protein kinase c zeta type
protein    /    calcium-binding protein    /    annexin    /    Protein kinase c zeta type
protein    /    calcium-binding protein    /    transferase    /    Protein kinase c zeta type
protein    /    calcium-binding protein    /    kinase    /    Protein kinase c zeta type
DTO Classes
protein    /    Kinase    /    Protein kinase    /    AGC group    /    PKC family    /    PKC iota subfamily    /    Protein kinase c zeta type

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.