Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Matrix metalloproteinase-17 |
|---|
Gene and Protein Information
| Gene ID | 4326 |
|---|---|
| Uniprot Accession IDs | Q9ULZ9 Q14850 MMP-17 |
| Ensembl ID | ENSP00000353767 |
| Symbol | MT4MMP MMP-17 MT4MMP MTMMP4 MT4-MMP |
| Family | Belongs to the peptidase M10A family. |
| Sequence | MRRRAARGPGPPPPGPGLSRLPLPLLLLLALGTRGGCAAPAPAPRAEDLSLGVEWLSRFGYLPPADPTTGQLQTQEELSKAITAMQQFGGLEATGILDEATLALMKTPRCSLPDLPVLTQARRRRQAPAPTKWNKRNLSWRVRTFPRDSPLGHDTVRALMYYALKVWSDIAPLNFHEVAGSAADIQIDFSKADHNDGYPFDGPGGTVAHAFFPGHHHTAGDTHFDDDEAWTFRSSDAHGMDLFAVAVHEFGHAIGLSHVAAAHSIMRPYYQGPVGDPLRYGLPYEDKVRVWQLYGVRESVSPTAQPEEPPLLPEPPDNRSSAPPRKDVPHRCSTHFDAVAQIRGEAFFFKGKYFWRLTRDRHLVSLQPAQMHRFWRGLPLHLDSVDAVYERTSDHKIVFFKGDRYWVFKDNNVEEGYPRPVSDFSLPPGGIDAAFSWAHNDRTYFFKDQLYWRYDDHTRHMDPGYPAQSPLWRGVPSTLDDAMRWSDGASYFFRGQEYWKVLDGELEVAPGYPQSTARDWLVCGDSQADGSVAAGVDAAEGPRAPPGQHDQSRSEDGYEVCSCTSGASSPPGAPGPLVAATMLLLLPPLSPGALWTAAQALTL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 452375 | MMP17 | matrix metallopeptidase 17 | 9598 | VGNC:5480 | OMA, EggNOG |
| Macaque | 100430708 | MMP17 | matrix metallopeptidase 17 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 23948 | Mmp17 | matrix metallopeptidase 17 | 10090 | MGI:1346076 | Inparanoid, OMA, EggNOG |
| Rat | 288626 | Mmp17 | matrix metallopeptidase 17 | 10116 | RGD:1311541 | Inparanoid, OMA, EggNOG |
| Horse | 100062342 | MMP17 | matrix metallopeptidase 17 | 9796 | VGNC:20227 | Inparanoid, OMA, EggNOG |
| Cow | 513072 | MMP17 | matrix metallopeptidase 17 | 9913 | VGNC:31522 | Inparanoid, OMA, EggNOG |
| Pig | 100154230 | MMP17 | matrix metallopeptidase 17 | 9823 | OMA, EggNOG | |
| Opossum | 100028499 | MMP17 | matrix metallopeptidase 17 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 416801 | MMP17 | matrix metallopeptidase 17 | 9031 | CGNC:1761 | Inparanoid, OMA |
| Anole lizard | MMP17 | matrix metallopeptidase 17 [Source:HGNC Symbol;Acc:HGNC:7163] | 28377 | Inparanoid, OMA | ||
| Xenopus | 100125088 | mmp17 | matrix metallopeptidase 17 | 8364 | XB-GENE-963679 | Inparanoid, OMA |
| Zebrafish | 570076 | mmp17a | matrix metallopeptidase 17a | 7955 | ZDB-GENE-070820-2 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Spezifikationen | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.