Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Mediator of RNA polymerase II transcription subunit 19 |
|---|
Gene and Protein Information
| Gene ID | 219541 |
|---|---|
| Uniprot Accession IDs | A0JLT2 Q8IV02 Q8IZD1 |
| Ensembl ID | ENSP00000337340 |
| Symbol | LCMR1 LCMR1 DT2P1G7 MED19AS |
| Family | Belongs to the Mediator complex subunit 19 family. |
| Sequence | MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPDRKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 451200 | MED19 | mediator complex subunit 19 | 9598 | VGNC:53068 | OMA, EggNOG |
| Macaque | 704421 | MED19 | mediator complex subunit 19 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 381379 | Med19 | mediator complex subunit 19 | 10090 | MGI:1914234 | Inparanoid, OMA, EggNOG |
| Rat | 311165 | Med19 | mediator complex subunit 19 | 10116 | RGD:1311926 | Inparanoid, OMA, EggNOG |
| Dog | 612925 | MED19 | mediator complex subunit 19 | 9615 | VGNC:43128 | Inparanoid, OMA, EggNOG |
| Horse | 100066998 | MED19 | mediator complex subunit 19 | 9796 | VGNC:20077 | Inparanoid, OMA, EggNOG |
| Cow | 509245 | MED19 | mediator complex subunit 19 | 9913 | VGNC:31356 | Inparanoid, OMA, EggNOG |
| Pig | 100520359 | MED19 | mediator complex subunit 19 | 9823 | OMA, EggNOG | |
| Opossum | 100022927 | MED19 | mediator complex subunit 19 | 13616 | OMA, EggNOG | |
| Chicken | 428854 | MED19 | mediator complex subunit 19 | 9031 | CGNC:5547 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100556094 | med19 | mediator complex subunit 19 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | MED19 | mediator complex subunit 19 [Source:HGNC Symbol;Acc:HGNC:29600] | 8364 | OMA, EggNOG | ||
| Zebrafish | 445021 | med19b | mediator complex subunit 19b | 7955 | ZDB-GENE-040727-4 | OMA, EggNOG |
| C. elegans | 175378 | mdt-19 | Mediator of RNA polymerase II transcription subunit 19 | 6239 | Inparanoid, OMA, EggNOG | |
| Fruitfly | 39987 | MED19 | Mediator complex subunit 19 | 7227 | FBgn0036761 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.