🌎 Versand an: United States
Navigation umschalten
Warenkorb
Suche
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Struktur Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

MMAB

BeschreibungCorrinoid adenosyltransferase

Gene and Protein Information

Gene ID326625
Uniprot Accession IDs Q96EY8 C5HU05 Q9BSH0
Ensembl ID ENSP00000445920
Symbol ATR cob cblB CFAP23
FamilyBelongs to the Cob(I)alamin adenosyltransferase family.
Sequence
MAVCGLGSRLGLGSRLGLRGCFGAARLLYPRFQSRGPQGVEDGDRPQPSSKTPRIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATPCSSAREAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYMKNDPSAESEGL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp452403MMABmethylmalonic aciduria (cobalamin deficiency) cblB type9598OMA, EggNOG
Macaque708973MMABmethylmalonic aciduria (cobalamin deficiency) cblB type9544Inparanoid, OMA
Mouse77697Mmabmethylmalonic aciduria (cobalamin deficiency) cblB type homolog (human)10090MGI:1924947Inparanoid, OMA, EggNOG
Rat687861Mmabmethylmalonic aciduria (cobalamin deficiency) cblB type10116RGD:1596242Inparanoid, OMA
Dog486310MMABmethylmalonic aciduria (cobalamin deficiency) cblB type9615Inparanoid, OMA, EggNOG
Horse100066641MMABmethylmalonic aciduria (cobalamin deficiency) cblB type9796Inparanoid, OMA, EggNOG
Cow617636MMABmethylmalonic aciduria (cobalamin deficiency) cblB type9913Inparanoid, OMA, EggNOG
Pig100157459MMABmethylmalonic aciduria (cobalamin deficiency) cblB type9823Inparanoid, OMA, EggNOG
Opossum100028469MMABmethylmalonic aciduria (cobalamin deficiency) cblB type13616Inparanoid, OMA, EggNOG
Zebrafish557077mmabmethylmalonic aciduria (cobalamin deficiency) cblB type7955ZDB-GENE-060526-232Inparanoid, OMA, EggNOG
C. elegans175661mmab-1MethylMalonic Aciduria type B homolog6239Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    oxidoreductase    /    dehydrogenase    /    Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial
DTO Classes
protein    /    Enzyme    /    Oxidoreductase    /    Dehydrogenase    /    Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpezifikationenSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Dürfen wir Sie über Rabattaktionen informieren?

      Später erinnern

      Vielen Dank! Bitte überprüfen Sie Ihren E-Mail-Posteingang, um zu bestätigen.

      Hoppla! Benachrichtigungen sind deaktiviert.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.