🌎 Ship to: United States
Toggle Nav
Cart
Search
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

EEF1E1

BeschreibungEukaryotic translation elongation factor 1 epsilon-1

Gene and Protein Information

Gene ID9521
Uniprot Accession IDs O43324 C9JLK5 Q5THS2
Ensembl ID ENSP00000369038
Symbol AIMP3 P18 P18 AIMP3
Sequence
MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp462423EEF1E1eukaryotic translation elongation factor 1 epsilon 19598OMA, EggNOG
Macaque695426EEF1E1eukaryotic translation elongation factor 1 epsilon 19544Inparanoid, OMA, EggNOG
Mouse66143Eef1e1eukaryotic translation elongation factor 1 epsilon 110090MGI:1913393Inparanoid, OMA, EggNOG
Rat291057Eef1e1eukaryotic translation elongation factor 1 epsilon 110116RGD:1311056Inparanoid, OMA, EggNOG
Dog478717EEF1E1eukaryotic translation elongation factor 1 epsilon 19615Inparanoid, OMA
Cow617105EEF1E1eukaryotic translation elongation factor 1 epsilon 19913Inparanoid, OMA
Chicken420865EEF1E1eukaryotic translation elongation factor 1 epsilon 19031CGNC:9688Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.