MCL1

BeschreibungInduced myeloid leukemia cell differentiation protein Mcl-1

Gene and Protein Information

Gene ID4170
Uniprot Accession IDs Q07820 B2R6B2 D3DV03 D3DV04 Q9HD91 Q9NRQ3 Q9NRQ4 Q9UHR7 Q9UHR8 Q9UHR9 Q9UNJ1
Ensembl ID ENSP00000358022
Symbol BCL2L3 TM EAT MCL1L MCL1S Mcl-1 BCL2L3 MCL1-ES bcl2-L-3 mcl1/EAT
FamilyBelongs to the Bcl-2 family.
Sequence
MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp457274MCL1MCL1, BCL2 family apoptosis regulator9598VGNC:1312OMA, EggNOG
Macaque707539MCL1MCL1, BCL2 family apoptosis regulator9544Inparanoid, OMA, EggNOG
Mouse17210Mcl1myeloid cell leukemia sequence 110090MGI:101769Inparanoid, OMA, EggNOG
Dog403537MCL1MCL1, BCL2 family apoptosis regulator9615VGNC:43079Inparanoid, OMA, EggNOG
Horse100054765MCL1MCL1, BCL2 family apoptosis regulator9796VGNC:20032Inparanoid, OMA, EggNOG
Cow788087MCL1MCL1, BCL2 family apoptosis regulator9913Inparanoid, OMA, EggNOG
Opossum100017262MCL1MCL1, BCL2 family apoptosis regulator13616Inparanoid, OMA, EggNOG
Anole lizard100556744mcl1MCL1, BCL2 family apoptosis regulator28377Inparanoid, EggNOG
Xenopus100038211mcl1MCL1, BCL2 family apoptosis regulator8364XB-GENE-487620Inparanoid, EggNOG
Zebrafish58122mcl1aMCL1, BCL2 family apoptosis regulator a7955ZDB-GENE-000511-7Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.