🌎 Ship to: United States
Toggle Nav
Cart
Search
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

LTC4S

BeschreibungLeukotriene C4 synthase

Gene and Protein Information

Gene ID4056
Uniprot Accession IDs Q16873 Q8N6P0 Q9UC73 Q9UD18 LTC4 synthase
Ensembl ID ENSP00000292596
FamilyBelongs to the MAPEG family.
Sequence
MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp739986LTC4Sleukotriene C4 synthase9598VGNC:13542OMA, EggNOG
Mouse17001Ltc4sleukotriene C4 synthase10090MGI:107498Inparanoid, EggNOG
Rat114097Ltc4sleukotriene C4 synthase10116RGD:620677Inparanoid, OMA, EggNOG
Dog607316LTC4Sleukotriene C4 synthase9615VGNC:51742Inparanoid, OMA, EggNOG
HorseLTC4Sleukotriene C4 synthase [Source:HGNC Symbol;Acc:HGNC:6719]9796OMA, EggNOG
Cow511749LTC4Sleukotriene C4 synthase9913VGNC:31076Inparanoid, OMA, EggNOG
Pig100520063LTC4Sleukotriene C4 synthase9823OMA, EggNOG
OpossumLTC4Sleukotriene C4 synthase [Source:HGNC Symbol;Acc:HGNC:6719]13616Inparanoid, EggNOG
Chicken770619LTC4Sleukotriene C4 synthase9031CGNC:56163Inparanoid, OMA
Xenopus100127769ltc4s.2leukotriene C4 synthase, gene 28364XB-GENE-981579Inparanoid, OMA, EggNOG
Zebrafish100535432ltc4sleukotriene C4 synthase7955ZDB-GENE-110411-32Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.