🌎 Ship to: United States
Navigation umschalten 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | Lysosomal acid lipase/cholesteryl ester hydrolase |
|---|
Gene and Protein Information
| Gene ID | 3988 |
|---|---|
| Uniprot Accession IDs | P38571 B2RBH5 D3DR29 Q16529 Q53H21 Q5T074 Q5T771 Q96EJ0 Acid cholesteryl ester hydrolase |
| Ensembl ID | ENSP00000337354 |
| Symbol | LAL CESD |
| Family | Belongs to the AB hydrolase superfamily. Lipase family. |
| Sequence | MKMRFLGLVVCLVLWTLHSEGSGGKLTAVDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 466150 | LIPA | lipase A, lysosomal acid type | 9598 | VGNC:7847 | OMA, EggNOG |
| Mouse | 16889 | Lipa | lysosomal acid lipase A | 10090 | MGI:96789 | Inparanoid, OMA, EggNOG |
| Rat | 25055 | Lipa | lipase A, lysosomal acid type | 10116 | RGD:3008 | Inparanoid, OMA, EggNOG |
| Dog | 100856363 | LIPA | lipase A, lysosomal acid type | 9615 | VGNC:42693 | Inparanoid, OMA, EggNOG |
| Horse | 100071626 | LIPA | lipase A, lysosomal acid type | 9796 | VGNC:19685 | Inparanoid, OMA, EggNOG |
| Cow | 100125267 | LIPA | lipase A, lysosomal acid type | 9913 | VGNC:30904 | Inparanoid, OMA, EggNOG |
| Pig | 100142668 | LIPA | lipase A, lysosomal acid type | 9823 | Inparanoid, OMA, EggNOG | |
| Chicken | 423789 | LIPA | lipase A, lysosomal acid type | 9031 | CGNC:4801 | Inparanoid, OMA |
| Zebrafish | 406713 | lipf | lipase, gastric | 7955 | ZDB-GENE-040426-2737 | Inparanoid, OMA |
Protein Classes
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.