🌎 Ship to: United States
Navigation umschalten
Cart
Search
Versand am selben Tag für alle vorrätigen Artikel.
Erweiterte Suche
Schnelle Bestellung SDS / CoA Structure Masse & benutzerdefinierte
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager

MT-CO2

BeschreibungCytochrome c oxidase subunit 2

Gene and Protein Information

Gene ID4513
Uniprot Accession IDs P00403 Q37526
Ensembl ID ENSP00000354876
Symbol COII COX2 COXII MTCO2 COII MTCO2
FamilyBelongs to the cytochrome c oxidase subunit 2 family.
Sequence
MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYALFLTLTTKLTNTNISDAQEMETVWTILPAIILVLIALPSLRILYMTDEVNDPSLTIKSIGHQWYWTYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDNRVVLPIEAPIRMMITSQDVLHSWAVPTLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp807864MT-CO2mitochondrially encoded cytochrome c oxidase II9598VGNC:11715Inparanoid, OMA, EggNOG
Macaque2846628COX2cytochrome c oxidase subunit II9544OMA, EggNOG
Mouse17709mt-Co2mitochondrially encoded cytochrome c oxidase II10090MGI:102503Inparanoid, OMA, EggNOG
Rat26198Mt-co2mitochondrially encoded cytochrome c oxidase II10116RGD:621872Inparanoid, OMA, EggNOG
Dog804479MT-CO2mitochondrially encoded cytochrome c oxidase II9615VGNC:53137Inparanoid, OMA, EggNOG
Horse807845COX2cytochrome c oxidase subunit II9796Inparanoid, OMA, EggNOG
Cow3283880COX2cytochrome c oxidase subunit II9913Inparanoid, OMA, EggNOG
Pig808504COX2cytochrome c oxidase subunit II9823Inparanoid, OMA, EggNOG
Opossum3074663COX2cytochrome c oxidase subunit II13616OMA, EggNOG
Platypus808709COX2cytochrome c oxidase subunit II9258Inparanoid, EggNOG
Anole lizard6385975COX2cytochrome c oxidase subunit II28377Inparanoid, OMA, EggNOG
Xenopus3283495COX2cytochrome c oxidase subunit II8364Inparanoid, OMA
Zebrafish140540mt-co2cytochrome c oxidase II, mitochondrial7955ZDB-GENE-011205-15Inparanoid, OMA, EggNOG
C. elegans2565697COX2cytochrome c oxidase subunit II6239Inparanoid, OMA, EggNOG
Fruitfly19893535COX2cytochrome c oxidase subunit II7227FBgn0013675Inparanoid, EggNOG
S.cerevisiae854622COX2cytochrome c oxidase subunit 24932S000007281Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.