🌎 Ship to: United States
Toggle Nav
Cart
Search
Versand am selben Tag für Lagerartikel
Erweiterte Suche
Schnellbestellung SDS / CoA Structure Großmengen & Sonderanfragen
Menü
Konto
Einstellungen
྾
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel

LGALS4

BeschreibungGalectin-4

Gene and Protein Information

Gene ID3960
Uniprot Accession IDs P56470 Gal-4
Ensembl ID ENSP00000302100
Symbol GAL4 L36LBP
Sequence
MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameSteuer-IDOther Gene IDSources
Chimp456011LGALS4galectin 49598VGNC:10392OMA, EggNOG
Macaque694195LGALS4galectin 49544Inparanoid, OMA, EggNOG
Mouse16855Lgals4lectin, galactose binding, soluble 410090MGI:107536OMA, EggNOG
Rat25474Lgals4galectin 410116RGD:3003Inparanoid, OMA, EggNOG
Dog484521LGALS4galectin 49615VGNC:42649Inparanoid, OMA, EggNOG
Horse100064337LGALS4galectin 49796VGNC:19643Inparanoid, OMA, EggNOG
Cow614804LGALS4galectin 49913VGNC:30854Inparanoid, OMA, EggNOG
Pig397041LGALS4galectin 49823Inparanoid, EggNOG
Opossum100011146LGALS4galectin 413616Inparanoid, OMA, EggNOG
Anole lizard100567030lgals4galectin 428377Inparanoid, OMA, EggNOG
Xenopus496937lgals4.1lectin, galactoside-binding, soluble, 4, gene 18364XB-GENE-992854OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelVerfügbarkeitDetails anzeigen

Associated Antibodies

NameSpecificationsSpecies reactivityAnwendungVerfügbarkeitDetails anzeigen

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Wir verwenden Cookies, um die ordnungsgemäße Funktion der Website sicherzustellen und, soweit zulässig, Ihr Nutzererlebnis zu verbessern. Sie können Ihre Einstellungen jederzeit unter „Einstellungen“ verwalten. Weitere Informationen finden Sie in unserer Cookie-Richtlinie.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.