Navigation umschalten 
Suche
340,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag für Lagerartikel
| Beschreibung | Ragulator complex protein LAMTOR2 |
|---|
Gene and Protein Information
| Gene ID | 28956 |
|---|---|
| Uniprot Accession IDs | Q9Y2Q5 Q5VY97 Q5VY98 Q5VY99 |
| Ensembl ID | ENSP00000357288 |
| Symbol | MAPBPIP ROBLD3 p14 ENDAP ROBLD3 HSPC003 MAPBPIP MAPKSP1AP Ragulator2 |
| Family | Belongs to the GAMAD family. |
| Sequence | MLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLTQVAAS |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 107973412 | LAMTOR2 | late endosomal/lysosomal adaptor, MAPK and MTOR activator 2 | 9598 | VGNC:8350 | Inparanoid, OMA, EggNOG |
| Macaque | 718110 | LAMTOR2 | late endosomal/lysosomal adaptor, MAPK and MTOR activator 2 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 83409 | Lamtor2 | late endosomal/lysosomal adaptor, MAPK and MTOR activator 2 | 10090 | MGI:1932697 | Inparanoid, OMA, EggNOG |
| Rat | 295234 | Lamtor2 | late endosomal/lysosomal adaptor, MAPK and MTOR activator 2 | 10116 | RGD:1562501 | Inparanoid, OMA, EggNOG |
| Horse | 100063939 | LAMTOR2 | late endosomal/lysosomal adaptor, MAPK and MTOR activator 2 | 9796 | VGNC:19575 | Inparanoid, OMA, EggNOG |
| Cow | 616375 | LAMTOR2 | late endosomal/lysosomal adaptor, MAPK and MTOR activator 2 | 9913 | VGNC:30780 | Inparanoid, OMA, EggNOG |
| Pig | 100156749 | LAMTOR2 | late endosomal/lysosomal adaptor, MAPK and MTOR activator 2 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100017683 | LAMTOR2 | late endosomal/lysosomal adaptor, MAPK and MTOR activator 2 | 13616 | Inparanoid, OMA, EggNOG | |
| Xenopus | 448570 | lamtor2 | late endosomal/lysosomal adaptor, MAPK and MTOR activator 2 | 8364 | XB-GENE-992364 | Inparanoid, OMA, EggNOG |
| Zebrafish | 445155 | lamtor2 | late endosomal/lysosomal adaptor, MAPK and MTOR activator 2 | 7955 | ZDB-GENE-040801-63 | Inparanoid, OMA, EggNOG |
| C. elegans | 179177 | lmtr-2 | Ragulator complex protein LAMTOR2 homolog | 6239 | Inparanoid, OMA | |
| Fruitfly | 37122 | CG5189 | CG5189 gene product from transcript CG5189-RB | 7227 | FBgn0034350 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Spezifikationen | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Später erinnern
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.