🌎 Ship to: United States
Navigation umschalten 
Search
224,000+ Forschungsprodukte · Triple ISO certified · COA & SDS für jedes Produkt verfügbar · Versand am selben Tag auf Lager
| Beschreibung | Serine/threonine-protein kinase Nek7 |
|---|
Gene and Protein Information
| Gene ID | 140609 |
|---|---|
| Uniprot Accession IDs | Q8TDX7 A6NGT8 |
| Ensembl ID | ENSP00000356355 |
| Family | Belongs to the protein kinase superfamily. NEK Ser/Thr protein kinase family. NIMA subfamily. |
| Sequence | MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTASS Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Steuer-ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 736415 | NEK7 | NIMA related kinase 7 | 9598 | VGNC:11557 | OMA, EggNOG |
| Macaque | 710464 | NEK7 | NIMA related kinase 7 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 59125 | Nek7 | NIMA (never in mitosis gene a)-related expressed kinase 7 | 10090 | MGI:1890645 | Inparanoid, OMA, EggNOG |
| Rat | 360850 | Nek7 | NIMA-related kinase 7 | 10116 | RGD:1311160 | Inparanoid, OMA, EggNOG |
| Dog | 480008 | NEK7 | NIMA related kinase 7 | 9615 | VGNC:43734 | Inparanoid, OMA |
| Horse | 100061722 | NEK7 | NIMA related kinase 7 | 9796 | VGNC:20674 | Inparanoid, OMA |
| Cow | 781355 | NEK7 | NIMA related kinase 7 | 9913 | VGNC:31998 | Inparanoid, OMA |
| Opossum | 100026840 | NEK7 | NIMA related kinase 7 | 13616 | Inparanoid, OMA | |
| Chicken | 424350 | NEK7 | NIMA related kinase 7 | 9031 | CGNC:1586 | Inparanoid, OMA |
| Anole lizard | 100561378 | nek7 | NIMA related kinase 7 | 28377 | Inparanoid, OMA | |
| Xenopus | 780029 | nek7 | NIMA-related kinase 7 | 8364 | XB-GENE-962512 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Verfügbarkeit | Details anzeigen |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Anwendung | Verfügbarkeit | Details anzeigen |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.